KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3764Help
Entry
Dhaf_3764         CDS       T00822                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00051  Fructose and mannose metabolism
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dhaf_3764
Enzymes [BR:dhd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Dhaf_3764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACL21780
UniProt: B8FRM0
Position
complement(3998800..3999438)
Genome map
AA seq 212 aa AA seqDB search
MLKEKILEIGQKIAQSGMVAGTWGNISAWDSDRNGYWITPSGMDYFSLKEEDLVLLSMDN
TVLEGKRKPSSELLLHGQIYKQRPDVKGIVHTHSPFATAHAVSRLPLPGIVEDLVMIAGG
QVAVARYELPGTLELALSAVQALEDKNAVFLANHGLVGVGFSLAEAFKVCQVVEKSAQIH
IMSRLLGKPAALSPEDIQIMRRAYQESYGQRA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagagaaaattctggagatcggccaaaaaatagctcagagcggcatggtcgcc
ggtacttgggggaatatctccgcgtgggattctgaccgcaatgggtattggattactccc
agcggcatggattacttctccttgaaggaagaggatctggtactgctgagtatggataat
actgtgctggagggaaagcgcaagccgtcttcagagctgctgctccatgggcagatctat
aagcagcggcctgatgttaaaggaatcgtccacacccattctccatttgctacagcccat
gccgtatcccgccttcccctcccggggattgtggaggatttggtgatgattgccggaggt
caggtggcggtggcccgctatgagttacccggcacgctggagcttgcccttagtgctgtg
caggcgctggaagacaagaatgctgtctttctcgctaaccatggcttggtcggggttggc
ttctccttggctgaagcatttaaagtgtgtcaagttgtagaaaaaagtgctcagattcat
atcatgtcccggctcttgggtaaaccggcggcactaagccctgaagacattcaaatcatg
cgccgcgcttatcaggaaagctacggacaacgagcttag

DBGET integrated database retrieval system