KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4717Help
Entry
Dhaf_4717         CDS       T00822                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00010  Glycolysis / Gluconeogenesis
dhd00051  Fructose and mannose metabolism
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01120  Microbial metabolism in diverse environments
dhd01130  Biosynthesis of antibiotics
dhd01200  Carbon metabolism
dhd01230  Biosynthesis of amino acids
Module
dhd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dhd_M00002  Glycolysis, core module involving three-carbon compounds
dhd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dhaf_4717
   00051 Fructose and mannose metabolism
    Dhaf_4717
   00562 Inositol phosphate metabolism
    Dhaf_4717
Enzymes [BR:dhd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dhaf_4717
Exosome [BR:dhd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dhaf_4717
  Exosomal proteins of bladder cancer cells
   Dhaf_4717
  Exosomal proteins of melanoma cells
   Dhaf_4717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CO_dh
Motif
Other DBs
NCBI-ProteinID: ACL22712
UniProt: B8FXW1
Position
complement(5034650..5035417)
Genome map
AA seq 255 aa AA seqDB search
MAKRHPIIAGNWKMNKSLRETQEYAVKLLGVLGEVTAIDVVVCAPFTALNVLKNELEESV
IHIGAQDMFYAPDGAYTGEISAAMLVDVACTYVILGHSERREILRETDEEIAKKVKAALK
AGLTPILCVGENLANREEGKAFAIVRGQVEKDLTDLAPDDLKRVVIAYEPIWAIGTGKTA
SSEDAQEMCAMIRSTLAGIAGVVADEVNILYGGSVKADNIGELMSQPDVDGALVGGASLE
AEGFAQLVQNAVAVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgacatcctattatcgctggaaattggaagatgaataaaagtctccgggag
actcaggaatatgcggtaaagctcttaggagtgcttggcgaagtcactgcaatcgatgtt
gtcgtgtgtgcgccctttacagccttaaatgttctcaagaatgagctggaggagagcgtc
attcatattggggctcaggatatgttttatgcccccgatggggcttatacgggagagatc
tctgcggcgatgctggtggatgttgcctgcacctatgtcatcctcggacattcggagcgc
cgggaaattctccgtgaaacggatgaggagattgccaaaaaggtgaaggcggcccttaag
gcagggctcacccccattctctgtgtgggtgaaaacttagccaaccgggaagaaggcaag
gcctttgcaatcgtgcgcggccaggtggaaaaggatctgacggatcttgccccagatgat
ttgaaacgggtggtcattgcctacgaacctatttgggctatcggcacgggtaagacagcc
tccagtgaagatgcccaggagatgtgcgccatgattcgctctactttagccggaattgcc
ggtgtggttgccgatgaggtcaatatcctctatggcggcagtgttaaggcggacaatatt
ggtgagctcatgagtcagccggatgtggacggcgctctggtgggcggggccagcctggaa
gccgaaggatttgcccaattggttcagaatgcggtggctgttctatga

DBGET integrated database retrieval system