KEGG   Drosophila hydei: 111592845Help
Entry
111592845         CDS       T05888                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
dhe  Drosophila hydei
Pathway
dhe00520  Amino sugar and nucleotide sugar metabolism
dhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    111592845
Enzymes [BR:dhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     111592845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 SlyX adh_short
Motif
Other DBs
NCBI-GeneID: 111592845
NCBI-ProteinID: XP_023161049
Position
Unknown
AA seq 447 aa AA seqDB search
MSLTKKRIKIVSGSSLIGLALIYLYKVAIAPAVSVPGASPVAHVIEEQRQWPPTEDAVQR
NLQIAYEAQNALLMKQRQELLHTKEQLAQLEEQVRSLQASTPRKYPKVKYLNYKNRKRIL
ITGGAGFVGSHLVDDLMIQGHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDIVNPLFIE
IDEIYHLASPASPPHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSEVYGDPTVH
PQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPRMHMNDGR
VVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGLIALMASNYTQPVNLGNPVEQTIG
EFAKIIKHLVGGQSEVKQIKAMEDDPQRRKPDITRAKLRLNWEPKVPLETGLLQTISYFR
NELARSDRFQESSRKYFDSPDLQRSRP
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgacaaagaaacgcattaaaattgtatcgggcagctcgttaattggcctagcc
ctcatctatttgtacaaagttgcaattgcgcccgctgtcagtgttccaggtgccagtcct
gtggctcatgtgattgaggagcagcggcagtggccacccaccgaggatgccgtgcagcgt
aatctacaaattgcatatgaggcgcaaaatgcgctgctgatgaagcagcggcaggagctg
ctgcacaccaaggagcaactggcacagctggaggaacaggtgcgctccctgcaggccagc
acgccgcgaaaatatccgaaagtcaaatatcttaactataagaatcggaagcgtattttg
atcacgggtggcgccggctttgtgggctcccatctcgtggacgatcttatgatccaggga
catgaggtgattgtggtggataacttcttcacggggcgtaagcgcaacgtggaacattgg
ctgggacacgagaactttgagctcatccatcatgacattgtgaatccgctgttcatcgag
atcgatgagatctaccatctggcttcgcccgcatcgcctccccactatatgtacaatcca
gtaaagacgataaagacaaacaccatgggcaccatcaatgtgctgggattggccaaacgt
gtcatggctaaggtgttaattgccagcacttcggaggtctacggagatcctactgtgcat
ccacagccggagacctactggggtcatgtgaaccccataggtccacgtgcctgctacgat
gagggcaaacgcgtctccgagacgctcagctacgcatatgccaagcaggagaaggtgcaa
gtgcgcgtcgcgcgcatctttaacacgtacggaccgaggatgcatatgaacgatggacgc
gtcgtgtcgaactttatattgcaggcgctgcgcaatgagacgatcacggtttatggcaac
ggcaagcagacgcgttcgtttcaatatgtttcggatctggtcgatggtttgatcgcactg
atggcttccaattacacgcagcccgtgaacctgggcaatcccgtcgagcagacgatcggc
gagtttgccaagatcatcaagcatctggttggcggccagagcgaggtgaaacagatcaag
gccatggaggatgatccgcagcgccgcaagccggacatcacgcgcgccaagctgcgtctc
aactgggagcccaaagtgcccctggagacgggtctactgcagaccatatcatattttcgc
aatgagctcgctcgcagcgaccgcttccaggagagctcccgcaagtacttcgactcgccc
gatctgcagcgcagtcggccatag

DBGET integrated database retrieval system