KEGG   Drosophila hydei: 111593686Help
Entry
111593686         CDS       T05888                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
dhe  Drosophila hydei
Pathway
dhe00350  Tyrosine metabolism
dhe01100  Metabolic pathways
Module
dhe_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111593686
Enzymes [BR:dhe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     111593686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 111593686
NCBI-ProteinID: XP_023162350
Position
Unknown
AA seq 244 aa AA seqDB search
MSALRNKVRKYLHLAKNRIRSSSSMASSDTRPVLYSYYYSSCSWRVRIALGLKKIPYDIR
PTSLTKADATYCYTNEYREINPMQQVPALKIDGQTLCDSVAIMHYLDETRPENPLLPQDP
HKRAKVREIVEIICSGIQPLQNRLVLAHLGKEKSMEWAQHWISRGFRGLESVLAASSGKY
CVGDEISMADCCLVPQVFNARRYHVNLDAYPKIVQLDQTLAANEIIRTCHPHSQPDCPPK
LANK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacttagaaacaaagtacggaaatatctacatttggccaagaatcggatacgt
agttccagttctatggcttccagcgatacaaggcctgtgctttactcatattactacagt
tcgtgttcctggcgagtgcgtattgcactgggcttgaaaaagataccatatgatattagg
ccaaccagtctgaccaaggctgatgctacatactgttatacgaatgaatatcgggagatt
aatcccatgcaacaggtgccagcccttaaaatcgatggacagacactttgtgattcggtg
gccattatgcattatctggatgaaacacgaccggaaaaccccttgctgcctcaagatccg
cataagcgtgccaaggtgcgcgagattgtcgagatcatttgttcgggcattcagccactg
cagaatcgccttgtattagcccatctgggtaaggaaaagagcatggaatgggcgcagcat
tggatatcacgtggctttcgtggtctagagagcgtactcgccgcttcgtctggcaagtac
tgtgtaggggatgaaatctccatggcagactgctgtctagttccacaggttttcaatgct
agaagataccatgtcaacctggatgcgtatcccaaaattgtgcagctcgaccagacttta
gcagctaatgaaattattcgcacctgccatcctcacagtcagcccgactgtccacccaag
ttggcaaacaaataa

DBGET integrated database retrieval system