KEGG   Drosophila hydei: 111593696Help
Entry
111593696         CDS       T05888                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dhe  Drosophila hydei
Pathway
dhe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111593696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dhe03041]
    111593696
Enzymes [BR:dhe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111593696
Spliceosome [BR:dhe03041]
 Complex C
  Other components
   Step II factors
    111593696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Flavi_DEAD AAA
Motif
Other DBs
NCBI-GeneID: 111593696
NCBI-ProteinID: XP_023162403
Position
Unknown
AA seq 1266 aa AA seqDB search
MDELQQLEYLSLVSKICTELDNHLGINDKDLAEFIIDLEHKHRSYESFRKALLENGAEFP
DSLVQNLQRIINLMRPSRADGDAKIPAGEEGKGDKKSQLMKMFPGLALPNDKYSSKLGED
GASEDEDPKHKLKIRKNEMSDVDAAMMELEALEPGDRKEQQSVKENSSSSRDRHKNKERS
RSRERDRDRDRDRHREREQDRDRRRENDKHRERDKDNHRERERNRDRERDKEHRRRRSRS
REKRDHDHDRDHRKRRSSSRERHDRHEQRRRRSRSRSHERSSRHQQQAQQEKMPPPASGM
SDDPELGMIYSGKVANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVARNQT
VKVKVMSLTGQKVSLSMKEVDQESGRDLNPLSHAPEEDELALRDRNPDGPYNSTSSMLNL
QGNNIDGDEHESRKRVTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLLPKEEDDEAD
IEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQ
EMEAVPSNLNKNWIDPLPEDDSSRHLAANMRGMGAAPQEVPEWKKHVIGGKKSSFGKKTD
LTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGC
TQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLMEAE
LKTYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFEAPIF
TIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYE
RMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVV
DPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKCYRLYTERAYRDEMLPT
PVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTR
LGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKF
NQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVS
AGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELV
QTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISR
VRRRRN
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactgcaacagctggagtacctttcgctggtgtcaaaaatctgcacagagctt
gataaccatttgggtattaacgacaaagatttagccgagttcatcatagatttggagcac
aagcaccgcagctacgagtcgtttcgtaaagcgctactggaaaatggtgctgaatttccc
gattctctagtgcaaaatttgcagcgtatcattaatttaatgcgacctagtagagctgat
ggcgatgctaaaataccggctggagaggaaggcaagggagacaaaaaatcgcaactaatg
aaaatgtttcccggcttagctctgcctaatgacaaatacagcagcaagcttggcgaggac
ggggcgagcgaagacgaagatcccaagcacaagttgaaaataaggaaaaacgaaatgagc
gatgtggatgcggccatgatggaactagaggctctggagcctggcgaccgaaaggagcaa
cagtcagtaaaagagaacagtagtagctcacgtgatcgccacaagaacaaagaacgcagt
cgcagtcgcgagagagaccgcgatagggatagggataggcatcgagaaagggaacaagat
agggataggagaagggagaacgataagcatagagaacgagataaggataaccacagagaa
agggaacgaaatagggatagagagcgagataaggaacatcgtcgccggcgtagcaggtct
cgagagaaacgtgatcatgatcatgatcgtgaccatcgaaaacgtcgctccagttcccga
gagcgtcacgacagacacgagcaacgcagacgacgctcccgttcccgttctcacgagcgc
agcagtcgccatcaacagcaggcacagcaggagaaaatgccaccaccagcatctgggatg
agcgatgatccagagctcggtatgatttactccggaaaggtagcgaacatcgtgccattt
ggttgcttcgtgcagctgttcggcctgcgcaaacgctgggagggtctggtgcatatctcg
cagctacgcgccgaaggacgcgtcaccgatgtcaccgaggtggtggcacgcaatcagaca
gtgaaagtgaaggtgatgtcgctgactggccaaaaggtatcgctgtcaatgaaggaggtc
gatcaagagtctgggcgagatctcaatccactgtcgcatgcacccgaggaggatgagctg
gcattacgggatcgcaatcccgatggaccttacaacagcacctcctccatgctcaatctg
caaggcaacaacattgatggcgatgagcacgagtcccgcaagcgagtgacgcgcatctcc
agtcctgaacgttgggagataaagcagatgattagctcgggtgtgcttgaccgcagcgaa
atgcctgattttgatgaggagactgggctactgcccaaggaagaggacgacgaagcggat
attgaaatagaaattgtggaggaggagcctcccttcctctctggacatggacgagcattg
catgacctgtcgcccgtgcgaatagttaaaaatccagatggctcgctcgcccaggcagcg
atgatgcagtccgccttatcgaaggagcgacgtgaacagaaaatgttacagcgggaacag
gaaatggaagcagtacccagcaatctcaacaagaactggatcgatccgctgcccgaggat
gattcttcacgtcatctggcagccaatatgcgcggcatgggcgccgctccacaggaagtg
cctgagtggaagaaacacgtcatcgggggcaaaaaatcctcctttggcaagaagaccgat
ctgacgctcgtcgagcaacgccaatctctgcccatttataagctccgtgacgatcttatc
aaggccgtcactgataatcaaattctcattgtcattggcgaaacgggatccggcaagacc
acacaaattacacagtatctgggcgagtgtggatttacggccaggggtaagattggatgc
acccagcctcgtcgtgtggctgccatgtcggtggctaagcgagtggccgaggagtttggc
tgccgactgggccaggaggtgggctatacgatacgtttcgaggattgtaccagcccggag
acagtaatcaagtatatgacggacggtatgttgttgcgcgagtgtctgatggaggcggag
ctgaagacgtattctgtcatcatgttggatgaagctcacgagcgtacgattcacacagat
gtactcttcgggctgctgaagacggccgtccaaaagcgacctgaacttaagctgattgtc
acatcggccacgttggatgcggtgaagttttcgcagtatttctttgaagctcctattttt
acgatacctggacgcacgtttcccgtggaagtactgtacactaaggaaccagagacggac
tacttggatgcgtcacttataactgtaatgcaaatccatttgcgtgagccacccggcgat
atactgctcttcttaacaggacaggaggagattgacaccgcctgcgagatactctacgag
cgcatgaaaagcttgggtccagatgttcccgagctaatcatactgcctgtgtattcagca
cttccttccgagatgcaaacccgcatcttcgatccagcacccgcgggcagtcgcaaagtg
gtgattgctacgaatatagcggaaacatcgcttaccatcgatggtatcttctatgtggtc
gatcccggctttgttaaacagaaggtatacaattccaagacgggcatggattcccttgtg
gtcacgcccatttcccaggcagctgcaaaacagcgtgccggccgtgctggccgtactggg
cccgggaaatgctatcgcctctacacggagcgcgcttatcgggatgagatgctgccaaca
ccagtgccagagatccaacgtacaaatctggccaccacagtgttgcagctgaaaacgatg
ggcatcaatgatttgctgcactttgatttcatggacgcgccacctgttgagtcgttggtc
atggcattagagcagctacattcgctctctgcgctcgatgatgagggtctgttaacacgt
cttggtcgtcgcatggctgagtttcccctcgagccaaatctatcgaagatgctcatcatg
tctgttgcgcttcagtgctcggatgagatcctaacaattgtctcaatgctcagcgtacag
aacgtgttttatagacccaaggataaacaggcgttggccgatcagaaaaaggccaagttt
aatcaagcagagggtgatcatctaactctgctggcggtatataacagctggaagaacaac
aaattctcgaacgcctggtgctatgagaactttgtgcaaatccgcacgctgaaacgttcg
caggatgtacggaagcaactgctcggcatcatggatcgccataagctagacgttgtttca
gctggcaagaattcggtgcgcatacaaaaagccatatgctccgggttctttagaaatgca
gccaaaaaggatccacaagaaggctatcgcacccttgttgattcgcaagtagtttatata
cacccatctagcgctctatttaatcgacagcccgaatgggttatctaccatgagctggtg
caaacgacaaaggagtatatgcgcgaagtaacaactattgatcccaaatggttagtggag
tttgcaccatcctttttccgtttctctgatcctaccaaactcagcaaattcaagaagaac
caacgactggagccgctctacaacaagtacgaagagccaaacgcgtggcggatatcgcgc
gtgcgtcgccgtcgtaattaa

DBGET integrated database retrieval system