KEGG   Drosophila hydei: 111594150Help
Entry
111594150         CDS       T05888                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
dhe  Drosophila hydei
Pathway
dhe00230  Purine metabolism
dhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111594150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dhe01001]
    111594150
Enzymes [BR:dhe01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     111594150
Protein kinases [BR:dhe01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   111594150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 111594150
NCBI-ProteinID: XP_023163092
Position
Unknown
AA seq 1165 aa AA seqDB search
MWLLKLIVGLGLLLFEIGLGLHLGGKRSDIESWEGSERVVDGISHQARSSNGNFNGHSND
SIDIKVFERIREPKNQAGSLNESDISRMRVYNVGVLMASHLDSPFDLERCGPAVDLALDQ
INKRFLSPHNIRLVKKKASYPSCSGAKAPGLAADMHFKDDVIAFIGPACAFALEPVARLA
AYWNTPIITGMGDQPPSSEGELTVTSGMLGRIHKWKNESTGMFKDKSKYPTLTRMSYCQC
RLKLVFASVFRQFNWKHVALLVDRSELFSLTVGKNLEYGLRQEGLLSFVRELNGNEEEIY
ENYLKDASMYARVVILSVRGVLVRKFMLAAHSLGMTNGEWVFLDVEIFQSAYWGDKDWEL
GDENDMRARKAYEALLRVSLLQPTSPTFQDFADNVRENALTEYNYTFGEGEEVNFFIGAF
YDGVYLLGMALNETLTEGGDIRDGVNITRRMWNRTFHGITGHVRIDDNGDRDADYSILDL
DPINGKFSVVAHYYGLHRKYAAAHGKKIHWPGGREEPPPDIPPCGFLGNAPDCHGNETTI
MYSVFGLALFLGLVLLVICLLQKQMKLSKELHNMSWRVRPEDVLIEMGGMFGSKGGLQRL
DVENISLQQFGIHSGRASIASFASLPPQVYTTIGQFKGERVAIKKVNVKKVEVTSTLLWE
IKQARDVSHENTVRFVGACIDLPRPTVLILTEYCSRGSLKDVLENEAIELDWNFRMSLIH
DIVKGMSYLHNCDVVAHGKLRSCNCLIDGRFVLKISDFGLSTLTTPSDFVRDQNYYTKLL
WIAPELLPMTSIPGCPATQRGDVYSFGIILEEIVNRGGPYQEARQQGMDVHTILHKVRQC
EYPPFRPLIRERECPPDLLVLMEKCWADNQEERPAFSTIRSNIRTIMKGFCENLMDDLLN
RMEHYANNLESLVEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEEFSSVTIY
FSDIVGFTELCARSTPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNG
DKHAREIALMALDILQAVCSFNLRHKPDYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDT
VNTASRLETTGMPGKIHVSSATKAILDKFGTFQLEHRGDVELKGKGTVTTYWLNSTTEAE
ARAPTPPLLNNDEVPFPLLFAGMGK
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgtggctattgaagctaattgtgggcttgggcctgttgctgttcgaaattggacttggt
ttgcatttgggtggcaagcggagcgatattgagtcgtgggagggcagtgaacgggttgtg
gacggcatcagtcatcaggcgaggtcgagcaatggcaacttcaatggccactcgaatgac
agcatcgatatcaaggtgttcgagcgcatccgagagcccaaaaaccaggctggctccctc
aatgagagcgacatcagccgaatgcgtgtttataatgtgggcgttctaatggcctcccat
ttggattcgccctttgacctggaacgttgtggacctgccgtggacctggcactagatcag
attaacaagcgcttcctcagtccgcacaacattcgactggtcaagaagaaggcaagctat
ccgtcttgctcgggcgccaaggcaccgggactggcagcggatatgcatttcaaggacgat
gtcattgcgtttataggacctgcgtgcgcctttgctctggagcctgttgctcgcctggcc
gcctactggaatacacccattataacgggcatgggcgatcagccaccttcatccgagggc
gaactcaccgtcacctccggcatgctgggcagaatacacaagtggaagaacgagagcacg
ggcatgttcaaagacaagtcgaagtacccaactttgacgcgaatgtcctactgccagtgc
cggctcaagctggtctttgccagcgtctttcgccagttcaactggaagcatgtggcgctg
ctggtggatcgatcggagctattctccttgacggtgggcaagaatctggagtacgggctg
cgacaggaggggctcttgagctttgtgcgcgagctgaatggcaatgaggaggagatctac
gagaactatctcaaggatgccagcatgtatgcgcgtgttgtcatattgtcggttcgcgga
gtcctcgtacgcaaattcatgttggccgcccacagcctgggcatgacaaatggcgagtgg
gtgttcctggacgtggagatattccagagtgcctactggggtgacaaggactgggagctg
ggcgatgaaaatgatatgcgagcacgcaaggcgtacgaggcgctgctgcgcgtctccctg
ctgcagccgaccagcccaaccttccaggactttgcggacaatgtgcgcgagaatgcgctc
accgaatacaactacaccttcggcgagggcgaggaggtgaacttcttcattggcgccttc
tacgatggcgtctacctgctcggcatggccctcaatgaaactctgaccgagggcggcgac
atccgagacggcgttaatattacgcgtcgcatgtggaaccgaacattccatgggattacg
ggacacgttcgcatagacgacaacggtgatcgcgatgctgactattccattctggatctc
gatcccatcaacggcaaattctctgttgtggcacactattacggccttcacagaaaatat
gcagcggcgcatggcaagaagattcattggcccggcggccgagaggagcctccaccggat
attccaccctgcggctttttgggcaacgctccggactgtcatggcaatgagaccacaatc
atgtactccgtattcggactagctctgtttctgggtcttgtgctgctggttatctgtctg
ctgcaaaaacaaatgaagctcagcaaggagctgcacaatatgtcgtggcgcgtgcgaccc
gaggatgtgcttatcgaaatgggtggcatgtttggctccaagggcgggctgcagcgcctg
gacgtggagaacatatcgctgcagcagtttggcatacactcgggtcgcgcttcgatcgcc
agcttcgcttcgctgccgccgcaggtgtacacaacgatcggacagttcaagggggagcgc
gtggccatcaagaaggtgaacgtgaagaaggtggaggtcacctcgacgctgctctgggag
atcaagcaggcgcgcgacgtgagccacgagaacacggtgcgctttgtgggcgcctgcatc
gatttgcccaggccaactgtgctcatcctgacggagtactgttcgcgaggcagcctgaag
gacgtgctggaaaatgaggccatcgagctggactggaactttcgcatgtctctgatacac
gacattgtcaagggcatgagctatctgcataactgcgatgtcgttgctcatggcaagctg
cgctcctgcaattgcctgatcgacggacgcttcgtcctgaagatctccgactttggcctg
agcacactgaccacgccctccgactttgtgcgcgatcagaactattataccaagctgctg
tggattgccccggagctgctgccaatgacatcgattcccggctgcccggccacacagcgc
ggcgatgtttattccttcggcattattctcgaggagatcgtcaatcgagggggaccctac
caggaggcgcgccaacagggcatggacgtgcacaccattctgcacaaggtgcgccagtgc
gagtacccacctttcaggccactcattcgggagcgagagtgtcccccggacctgctggtg
ttgatggagaagtgttgggccgacaaccaggaggagcgaccagccttctctaccatccgc
agcaacatccgcacgattatgaaaggattctgtgagaatctgatggatgatctactgaat
cgcatggagcactatgccaacaatttggaaagcctcgtggaggagaaaacgcggcagctg
agcctggagaaacaacgcaccgaggaactcttataccaaatcctgccacgtcctgtcgcc
cagcagctgatggctggagatctggtggagcccgaggagtttagcagcgtgaccatctac
ttcagcgacattgtgggcttcactgagctctgcgcccgtagcacacccatggatgtggtc
aacttcctcaatgatctctacagcacattcgatcgcatcattggcttctatgatgtctac
aaagtggagacaattggcgatgcctacctggtggtgtccggactgccagagcccaatggc
gataagcatgctcgagagattgcgctgatggccttggacatacttcaggctgtctgctcg
ttcaatctcagacacaagccggactataagatacagatacgcatcggcatgcactcgggc
tctgtgtgcgccggcgtcgtgggcaagaagatgccccactactgtctctttggcgacaca
gtgaacaccgcctcgcgtctggagacaacgggcatgcctggcaaaattcatgtttcgtcg
gccacaaaggccattctggacaaatttggcacctttcaattggagcatcgcggcgatgtg
gagctgaagggcaagggcactgtcaccacctattggctcaatagcaccacggaggcagag
gcacgtgcacccactccgcctctgctgaacaacgatgaggtgccttttcccttgctgttc
gctggcatgggcaagtga

DBGET integrated database retrieval system