KEGG   Drosophila hydei: 111594545Help
Entry
111594545         CDS       T05888                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
dhe  Drosophila hydei
Pathway
dhe00730  Thiamine metabolism
dhe00790  Folate biosynthesis
dhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    111594545
   00790 Folate biosynthesis
    111594545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dhe04147]
    111594545
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dhe00537]
    111594545
Enzymes [BR:dhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     111594545
Exosome [BR:dhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111594545
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dhe00537]
 Enzymes
  111594545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase ORC2
Motif
Other DBs
NCBI-GeneID: 111594545
NCBI-ProteinID: XP_023163665
Position
Unknown
AA seq 484 aa AA seqDB search
MTKSQRMKSFCLQLRFKSTQLFIVAGAVLLALLVSLLCIGFTIRFEVEHAVANVADVDYW
KDWVAIEQKLWYDKGIEELKRAMRVHSKQRQPRQVLLLMVHGIDAPALAAARFTNADISS
HANYIWDRFPHAARLKNSCSYSSPCDAAAAFRALWSGVPLAAVQRLRSNCSSSSNESELF
SVLQQAQLAGFRTGFVTNQRLTGALGAALYAQVTSSSWECDGLMPVGAIEAGCQDVAQQL
ISSATGQSMNVLLGGGRQLFNAKVPSFEWDPVDESLCRARAGRNLLRDWQSQKLKLKPSK
RFELLQQAHELSSINGSSVDYLLGVLANGDLSGSAQAPTLQLMLNKTLQVLQRPGVGHLL
VVEHHVKQPMLASEQLQLLNATLTDLLGHKELLTLVLLTNGNYLSASRDVSEETQLVSTL
DELFQGPELELQRRLQQMPSESLLFAQGPKSLLFYGVHDETYLAQALSYALGIDVFGRQL
IEDK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtcgcagcgtatgaaaagtttctgcctgcagctgcgtttcaagtcgacgcag
ttgttcatcgtggccggagctgtgttgttggcgctgctggtgtcgctgctgtgcattgga
tttaccattcgcttcgaggtggagcacgcggtggccaatgtggccgacgtggactactgg
aaggattgggtggccatcgagcagaagctctggtacgacaagggcatcgaggagctgaag
cgtgccatgcgcgtgcactcgaagcagcgacagccccggcaggtgctgctgctgatggtt
catggcatcgatgcacccgctctggctgcagctcgcttcactaacgccgatatcagctcc
cacgccaactacatctgggatcggtttccgcacgcagccaggttgaagaacagctgcagc
tacagctcgccctgtgatgcggcggctgcctttcgcgcactctggtcgggcgtgcctctg
gctgctgtgcagcgactgcggagcaactgcagcagcagcagcaacgaatcggagttgttt
agcgtgctgcagcaggcgcagctcgcgggttttcgcacgggttttgtgaccaatcaacgt
ttgacaggcgccttgggtgctgcgctctatgcgcaggtgacatccagcagctgggagtgc
gacggcttgatgccagtgggtgccatcgaggctggctgccaggatgtggcccaacagctc
atctcaagcgcaacggggcaatctatgaacgtgctgctcggcggcggacgacagctcttc
aatgccaaggtgcccagcttcgagtgggatccagtggatgagtcgctgtgccgtgccaga
gctggacgcaatctcttgcgcgactggcaaagtcagaagctgaagctcaagcccagcaag
cgtttcgagctgctgcagcaggcccatgagctgagctccatcaatggcagcagcgtggac
tacctgctgggcgtgctggccaatggagatttgagtggcagcgcccaggcacccacgctg
cagctgatgctgaataaaacgttgcaggtgctgcagcgaccaggcgttggccatctgctg
gtcgtggagcatcatgtcaaacagcccatgttggccagcgagcagctgcagttgctcaat
gcaacactcacggacttgttgggccacaaggagctgctcaccttggtgctgctgaccaat
ggcaactacctcagcgccagtcgagatgtgagcgaggagacgcagctggtgagcacgctg
gacgagctcttccaggggccagagttggagctgcagcgcagactgcagcagatgccatcg
gagagtttgctctttgcacaggggcccaaatcgttgctcttctatggcgtgcacgacgaa
acctatttggcccaggcattgtcctatgctctgggcattgatgtatttggcaggcagctt
atagaagataagtga

DBGET integrated database retrieval system