KEGG   Drosophila hydei: 111594644Help
Entry
111594644         CDS       T05888                                 

Definition
(RefSeq) mitogen-activated protein kinase p38b
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dhe  Drosophila hydei
Pathway
dhe04013  MAPK signaling pathway - fly
dhe04068  FoxO signaling pathway
dhe04624  Toll and Imd signaling pathway
dhe04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    111594644
   04068 FoxO signaling pathway
    111594644
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    111594644
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111594644
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dhe01001]
    111594644
Enzymes [BR:dhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111594644
Protein kinases [BR:dhe01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111594644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 111594644
NCBI-ProteinID: XP_023163806
Position
Unknown
AA seq 361 aa AA seqDB search
MPKFYKIEINRTEWDIPETYQNLQAVGQGAYGQVCKALVRGTSTKVAIKKLARPFQSAVH
AKRTYRELCLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQK
LSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNLAVNEDCELRILDFGLARPAESEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGT
PNDEFMNKISSESARTYIRSLPVMPRRNFRDVFRGANPLAIELLEKMLELDAEKRITAEQ
ALEHPYMEKWHDPSDEATSTLYDQSFEEDENTVEKWKEMVFTEVRRFKPPQAFADLLSQA
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaattttataaaattgagatcaatcgtaccgaatgggatattcctgaaacgtac
caaaatctccaggctgttggacagggtgcctacggccaagtgtgcaaggccctggtgcga
ggtacctcgacaaaggtggctattaagaaattagcccgtccttttcaatcggcagtgcat
gcgaagcgcacataccgtgagttatgtctcctaaagcacatggatcacgaaaatgttatt
ggactgctggatgtatttcatcccggccagccagccgattcgttggatcaatttcagcag
gtctacatggtaacacatcttatggacgctgatctaaataacattatacgcacgcagaag
ctatcagacgagcatgtgcaatttcttgtctatcagatattgcgtggattaaagtatatt
cacagcgctggggtcattcaccgtgatttgaaaccctccaatttggctgtaaatgaggat
tgcgagctgcgtatcttagatttcggactggctcgacccgctgagagtgaaatgacggga
tatgtggcaacgcgttggtatcgggcgccagaaattatgcttaactggatgcactacaat
cagacagttgacatttggtctgtgggctgcataatggctgagctgttaacgggacgtact
ctgtttccaggcaccgatcacatacaccagctgaatctaatcatggaggtgctcggcaca
cctaatgatgagtttatgaacaagatctcgtcggaaagcgcacgcacctatatacgatca
ttgcccgtgatgccgcgtcgcaatttccgtgacgtttttcgaggtgccaatccactggcc
attgaattgctggaaaagatgttggaactggatgcggaaaagcgtattacagctgaacag
gcacttgaacatccatatatggagaaatggcatgatcccagtgatgaggccacatcaacg
ctctacgatcaaagttttgaggaagatgaaaatacggtagagaaatggaaggagatggtg
tttaccgaagtacgacgttttaagccaccgcaggcatttgccgacctcttgtcgcaggct
caatag

DBGET integrated database retrieval system