KEGG   Drosophila hydei: 111595848Help
Entry
111595848         CDS       T05888                                 

Definition
(RefSeq) probable pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dhe  Drosophila hydei
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dhe01009]
    111595848
Enzymes [BR:dhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     111595848
Protein phosphatases and associated proteins [BR:dhe01009]
 HAD phosphatases
  Other HAD phosphatases
   111595848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-GeneID: 111595848
NCBI-ProteinID: XP_023165526
Position
Unknown
AA seq 300 aa AA seqDB search
MCEPKSRIKATPPRCLRCCPPCCNPCLCCPPECCKPCTAYCIFDLESAVFDTRQIYQRAC
RELLASYNKTLPEELILRSAPMETQEMAELICRKCKLPIAWENFLIQLNEHTCELIGNPP
MMEGVERLVTHLHENCIGLGLITGSSREIFCKKIRGREEFFGLFDLVLCADEYNRPKPEP
DCYLIAMRRLCDPPCAECCLAFDGTTKGVQAAKEARLKVIMLPEPELPCCWSELATQRLE
SLIEFNPEEFGMPYLEPLPEPPPPVTPEYSEPDHMEYSDAIANAQDDEEAAEDNEEPPVD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagccaaagagtagaataaaggcaacgcctcctcgttgcttgcgctgctgcccg
ccctgttgcaatccctgcctctgctgcccgcccgaatgctgcaagccatgcaccgcctac
tgcatattcgacttggagagtgcagtgtttgatactcgacaaatctatcaacgcgcctgc
cgtgagctcctggccagctataataagactttgccggaagagctgatcttgcgcagcgct
cccatggagacgcaggagatggctgagctgatctgccgcaagtgcaagctgcccatagcc
tgggagaactttctgatccaactgaacgagcacacgtgcgagctaattggcaatccgccg
atgatggaaggcgtggagcggctcgtcacccatctgcatgaaaattgcattggcctgggt
ctgatcacgggcagcagcagagagatcttctgcaagaaaatacgtggaagagaagagttc
ttcggcctgttcgatctggtgctgtgcgccgatgaatataataggcccaagccggagccg
gattgctatttgatagccatgcgtcggctctgtgatccgccctgcgccgagtgctgtttg
gccttcgatggcaccaccaaaggtgtgcaggcggctaaagaggcacgcttgaaggtcatt
atgctgcccgagccggagctgccttgctgctggtcagagctggcaacgcaacggctcgaa
tctttgatcgaattcaatcccgaggagtttggtatgccctacctggaaccgctgcccgaa
ccaccgccacctgtgacacctgaatatagcgagcctgaccacatggagtactccgacgcc
atcgccaacgcacaggatgatgaggaggcagctgaggacaacgaggagccacccgtcgat
tag

DBGET integrated database retrieval system