KEGG   Drosophila hydei: 111596139Help
Entry
111596139         CDS       T05888                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
dhe  Drosophila hydei
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dhe01001]
    111596139
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dhe04131]
    111596139
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dhe04812]
    111596139
   04147 Exosome [BR:dhe04147]
    111596139
Enzymes [BR:dhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111596139
Protein kinases [BR:dhe01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111596139
Membrane trafficking [BR:dhe04131]
 Others
  Actin-binding proteins
   Others
    111596139
Cytoskeleton proteins [BR:dhe04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111596139
Exosome [BR:dhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111596139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C1-set C2-set_2 Ig_4 V-set_CD47 Spectrin KilA-N HC2
Motif
Other DBs
NCBI-GeneID: 111596139
NCBI-ProteinID: XP_023165990
Position
Unknown
AA seq 8116 aa AA seqDB search
MERRQTLDSSMSSLYSASSSNRQLQLQPQSHSQSQTQLDAFNYSATMSSSSPTPSQATTS
SSLRATTIGTVVVRCGPIQLVIALLQSPEKIYIKVVELEPKITALGDNLDESLHMQREHD
ETLRNLQNLPGPMDEFVQKADKLLASKRISSELVNAMADTLNIIWQDILNLLQDRQHILH
LCTQFHDKMTQCFRRMDQLEGACNEAPLPAEVAGVQEFLNKFKQLRIDMLTGVMAALQDG
NELLSQLQELEKLETLDTRPEHIKRDATRAVHQVQQWLEALHDRRNSLELAWQTRKAQLE
QCLALKLLGRELIELEAALQQAKHELNTMYSLGECEHTANQTLLKYREWKQQALLLRDRA
LKITRAKEKVQAPGYFAGDEDCARAYAVLSICTEHLDLVDQREHWLQQSRDFFAKAEHTL
SVLEKLELELASVKLPPNSPESYAMFAKVSRDVRTFTEEPLRLGYGILDEVGRTQPETQG
IKRVLDELENRKAYIEGICANSSEDHQRVQRALTEFLSQHNELLAWLRASGQLQLQQSVN
MGRNLHQAKQFLLQHHELMQDLEVSKMSNSXWTLLTLTLTLTQIKGELINLLLESIKQHL
ESLSPQQRFDVDSKAEALHKHWIELKDLVLKRVDYVSLLIEFFEQANELSSQFDHLQRQL
LQTPDEHKLQFLQATWANIAASYAELKSSGQRFISLKIVDPYLETKPSVQAVEETLNGFS
KRQVDVTSSLENWTTTIAEKREVEYLLEKVMSDNEETVAKSTQVDTQLYPVFSTSSLDSK
QLLTSTREKLSYVTQDIERAQEEIQQRIQTTLSIQTKDQQSLTKIEQVINNLRMLKAKLD
GIKYDYRTLLESVLQFLENIVQLRREIDGYFAKQQSSATGPSSGVERTIAEHEKFRDQCM
DKFRSLITQSELLIDRVRVLEPPGAREIDTDRILKLLENLRIHFESNSSATMSTLERLEK
IEQFRSDLEDIDRSLDSVSKQLHDINGQSVDSLAAAKTTSLAFEYFERTIELLEKRIEKF
TETTSQQLFISNPESEAYVKDELRKLNDKWQSFKDQVKQKRKSLNQANEFFEVVEKIDAE
YREISYFYNSVSNKVPYLRDAVEASNLVNDIEKYVTTREPALRSKLDSASQCAHDMNKVS
TLYNDVMNIFQSFIKLKTDINTVQERLSQEQRQRDQREREARAQAEREKAIREAEARERV
AREEQARLEAQRQQAAIEQAQRELAARQLSLREQAVREEEARLQAVREQAAREQLAREQA
AREEEQRIQTLRDIAKREEELRMQALRDEEARLHIKREEELRIKREEEIRLRREEETRLQ
REEEARQKRENELRIQREEITRLQTLRDQVDQQRTVTENIRKDIQVNQIFTELRYASPLF
VRPLKDALTREGERFVFECEVTGTPEPSVEWFKDGISIQSNADYKTSFDKGICRLVIEET
FAADTARFSCRASNLVGTCDTNATLTVRENAAELQLVPPRILRFLESGKATEGTAFQFSC
VVSGVPLPTVQWFKNDKCIDDSPDYVISYNNGEAMLRFDEVFLEDDAVYTCSASNPAGIE
HCSASLIVEPLEPTELPCFKMPLQNAMARVGQKIKMEALVTGIPQPEICWLHNGKPFQPR
DSKYENGRVTLTIPQAYPNDAGSYVLSAKNLAGEAYSSCNIIVKGRLPNETSDSEMASDI
EPIRPAVHIPLKDVFIFEGKPVRLDCVIVGQPEPEVIWYHNERPVKESADVQLLFQGDRC
SLFIQEVCQEDGGNYKVVAINSAGEASSSCDLKVTSLNAEAASRVQLDRQSVPKESQPKF
ERLLSDVLTDEGEQVVLEVHANGDQPLKAQWYLANKELQLNERVTTQSDAEAGIFKLILN
NVAASDKGVYTVKVSNNAGDAKCFSHLIVKSVNAPENRRSSQSSVEIVERQLCPEFKELF
SDKQAHIDDVVKFECIVVGKPTPKVHWFFNDQPVHGHNFLVSTSGDRQVLTIQQLTHDAV
GKISCTAENDAGKATCVAFLNIIGSSPVPASSNLQTMTQEHNTESSRVTIKKQTFTTTST
SQVNSYEGNAPQTEVHHSSAHIDQSLKQLGQQRPEIVESHHYQELHKSKGMSSPAVQQKS
FTLVQSTNGAASVPAIGMPESPTRLRREIAPRFTTPLTGKIVDQGANVSMEAIYDSYPSP
EIKVEKNGDQLFDTPHTKISNKNNRVTIELKDVSVADAGRYAVTASNAAGQSTSTADLVV
KKTIFPPVFGRRLQAQVSRKGERLIMEVEVTGLPDPTVTWLKDDIPLQDAGISEHRLLAQ
GNSYKLIIEKAHTTDSGKYMVRATNAGGEAKSIADCVILEPSPERMQEVVKTIVYEAPAS
EFKTESHFNKEPQSYQTNQTDETTANDLHGLSESKVITEHRCTTEATMRLEHKSTYQDLP
ELSQRPKTPTTNTTNTTTTTSTNNTASMDQTDTQTSYKTGVTQTPPPVPPKPCAPVVGTA
FGQQAQAQPQPQQPPQMQTQINTRYESSSNEHKMSSSFEYFKKIDEETVTQRPKPQAQRP
LETVVRQPQAQTLAEELRSLNLIPGAPPEFCYTPKSEKQLPKQPLIHEKIKILEEVQPRE
PPPQGGVPVFPPPLNLQSVQHETTLTKEVKVEYGQPIVRPAAVLATPAQQNTRSPSPKPS
AEGVAMSKLWTPSGTAGYTSDVEQKTEHQISITKLPTPTPTKELNAPFLVQQVAKNITPP
TPAPVTRLVTVELEPGTPPEICFAPKQEEVRRHSLVESMEQKLEQNLMQGPSKVLPHSVP
TLTPVTAPKSNGTTSYRPPPPVMPNRLGAHYESDYESDRYKYSGSESDEPGNRARQQQAT
MESSFKSSGYAADTEEHSSYRKSESSFYETKSSTTTNPPAAAKLQPEPPAQLYFAPPAAP
QQTSYSQEAKNYKYTSSSMTSNMQQSSSSSTHHETKYSSNATPLVTPSPVPAQRKTPAAE
FSDYSSEVDERFRSVSRANESDSDIKGYRVVFPPTPTPRTNIANGHKSPVVVVTPSPMEF
EPMPPQVGSFRRPKFEPIGKEIRHEIKTESSSKQYSSSQQQQQQQPQPVFKPKPVAAKFI
AATQQQQQQPLPSSRPTMYYNAVAGTPMHMAKVAHETKNVMQMHESTESSQRVVNMQQTK
RVIHFDNQHQQQQQQQQQPAQEPFPYSPAGSRTPSRQSHLPPPATPTKFIPGEYRESDYE
SEVEGTRIQPLWSPYGDGLTKGYRRVAAPQSGGRSCSLPRSYERVLSPMEFDRGPEMPSK
IFVDVSTLRKEQRGGSTVTTQHRTQSLNRNSTLRQQFGNRLPDGSQDQTDLQQQQQQRSG
TLPRYGYSTLQQQAEGQGKRMGSSFLQKSHQFIEDVSRDMQSQQISSNGGLRPGFRRAPS
EGSNQPQAYRDESRVSQYVQQHQGGIGGTYVPPSLTHVYAQGDISPPVFEQIFKNARFAQ
GGNALFEGRLRGNPKPFVTWTRKGAPLLESQKFRMSYNEATGDVSLLINQIGPGDEGEYT
CTARNQYGEAICSVYIQPEGAPMPVLQPIQNLEKNIYSNGYSYTSIEEEFRVDTFEYRLL
REVSFREAITRRSSYEQDTQLSHELDRSLGPAHAPQISQKPRSSKLIEGSDAVFTARVGS
NPKPRLTWFHNGQRLVASQKYEISYSSGVATLRVKNANAKDGGHYTLLAENLQGCVVSSA
VLAVEPAAETTYEPKPVDMMAEQLEVGKALPPTFVKAFNEREVTEGRMTRFDCRVTGNPY
PEVFWFINGRQVRDDASHKILVNESGSHSLMITNVSRLDGGSVQCLARNKAGEVAIEAPL
HVLEKEQVVAPQFVQRFSTMTVREGEPISMSANAIGTPVPRITWQKDGVQISSTAERFVG
IDGGATCLEIPQVKATDAGWYQCTAQNIAGSTANRARLYVEVPREQPSQEQRRLNLPRPT
KVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGRVHMEAR
IEPVGDPSMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVSNASGV
AESRAILSVVQRPSIEQSSQNPNSLQYINQLEDYSRYQRQESSEELMNQAPQFIRPLRDL
GEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAED
AGNYTVRAVNRIGEAISQSTIRVHSRSQVTADLGIPEQQRYIEKVEELEDYRKSQQRRHV
QEAPEAIAPPQFKTPIQNQLDLREHAHAHFEARLEPIGDATMRVEWLKDGQPLEASSRIT
TYHNFGYVALTIKQITVYDAGTYICRAYNAMGQDTTTAQLTVVSKNEIVSDTQHPGGLQK
IQHLEDSSRYGRREEEETSITQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGMRIEW
YHNGRAITAANRIQMYYDFGYVALDISQVRAEDAGIYTVVARNKLGEAQLQATMVVETRS
NIDTSSMHRGLYEKTQNLENKQFVEPQYDIEEISKSKPVFVQPLTDPKPIHDGKNIHLEC
RLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIQATAADSGEYTVRATNHLG
TAHTSSCVRVIDRTDVVTETQNEQSLEQIQLLEDSRRRHHQEEDITIMQAPQFTRALHNI
ETVEGTNVHLECRLQPVGDPSMRIEWFVNGNPVKTGHRFRPAYEFDYVALDLLGCYAIDS
GVYTCQARNQLGEAVTSCSVRIIAKKDLILETQNESGLQKIQYLEDTSRYRRNEFVDEVV
NIRPRFLTHPKSLTNTREGAHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFG
YVALDIVGLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYLED
RSRYSRREEVDESTKQAPVFTTSLKNIEIKENQRAHFECRLIPVSDPSMRVEWYHNNMPL
KSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAFNAVGEAITSAVAVVHTKKSIYLESQ
HETALPRLQHLEDGSKRQRVSLQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDP
KLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASL
IVQSKTAIQLETQHEAAMHKIHQLEDHSKYQRREEEEYSVTTAPMFVTKLIGPTNLVEGQ
SAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCR
VTNNLGEAVNSIALNVTSRSSIIHDTQHEEALHKIQHLEDASRFQRKAEEDQFHAERPQF
GRPLRNAKVNEGTPVHLEATLIPVNDPTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDIL
YAHAEDTGTYMCKAKNAVGEAVTTCAVNVTANKTLDLDTLDAQRLEKIRQLESYAPPTKA
EVEEKGQKPIFLTPLSNLEHLKEGEHAHLECRVEPINDANLKIEWFCNGKQLPTGHRYRT
THDFGYVALDILYVYGEDTGTYMCKATNLLGEAVNTCNVRVLNRRSMILDTQHPDALEKI
QKLESKVVTTRTEVGDHPIGPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYH
NGKPLPSAARFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSSTNLRVIARGTI
ISDTQHPEGLEKIRKLESTAPHQRQEVETPGTRQRPVFTQPLQNIDRINEHQTAHFEARL
IPVGDPNLKVEWYRNEKLIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEA
VTTASMRVVTEATIQMDTQHPDSIRRIHQLEKPLAPLPTEPERLFEKPIFTQLLTGPSEV
WEGAHAHFEARVVPVGDPSLKFEWFVNGVELQMGSRLRTTHDFGFVTLDIAAVVPEDAGV
YMCRAYNAAGEAVSSTAMKVKTRANIDGQPLIPESWEAIRLKEAAMNRVPEMFVDSTPQQ
APVFTTHLQSYDKLHEGQHVHLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLV
TLSINGLREDDSAIYTCKATNQVGEAVSTSSLKIEDRPWLHAESLHPDSLPRIGELEAPK
EGRKDAPEPTYETPVFITHLNNIECKETDSVRFECNVEPARDPTMNIEWFYNGQLLQAAA
KFKSIYDFGYCALDLNNSYAENSGIYTCKATNSKGSATTSGTLKCTGGKTMFFDTQHPQG
ESGLEAVQETEEALANRYAQKPSKPETQYPPPVWTKPLQQEFHLSEAQPIHLEANVEPKE
DPNLFIEWYFNGKLLQHGSRFKMTSEFGFVTMDMIEVYSRDQGIYTCKAYNKAGEAFTST
TIFCSSKDSIIESTQHPKGAEGLEQIQDLEDSLRKDGSKPEQPEQGIAPRFTTEFVNIVD
IGEGELAHYEANLIPLGDQSMVIEWFFNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTG
TYTCRATNKYGSAEISCTLECVEKPRGQKPHFTSHIQPLQGLKDGQSAHFECTLIPVNDP
DLKVEWYHNGKLLRHSNRIKTVSDFGYVVLDIAYLQDHDSGEYVCRAYNKYGEDFTRTTL
NCGGRGGVFYDSLQPDSLQRIRELECPQGQQADTGAPVVAEPPKFITQISDVTKLVEGQS
AHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYECRA
YNKYGEDVTRATLKCASKASLILDSQLPRGMEGGLEKIANLEYSMVRTREETTEETRGKA
PVFTVPLENIDNLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVI
LEISPVYPEDSGEYSCRAINEYGEAVTTATMKIQGKRSIIMESQLPKGMEGTIDRIAELE
GLGSRSTEFVPEDDTGKPPEFITTPFDMVIGENSLAHFECRLQPINDPSMRVDWFHNGKA
LWAGSRIKTINDFGFVILEIAGCYQRDTGLYTCKATNKHGEATVSCKLQVKGRQGIVMEP
QLPSNFRTGTESLQKLEESMHKREEIVIDEEQPNPPKFIEDIKDNLDVPEGGPIHFDCRV
EPVGDPTMRIEWYYNGRVMATGSRVHQLNDFGFIALDIDYIYARDSGEYTCRATNKWGSA
TTTAKVTCKGKHSIVYDSQLPEGMTAEKLKELERGRIPEAPKVVEEQFGPPKFITQIASC
TAEESEAVRFECQVEPKTDPNLRVEWYRNGKPLPLGHRYRNVFDMGFVSLDILYVYSDDS
GEYVCRAVNKYGEDRTKATVSCKKLPTILLQNQVPRGMKRSETLTQMEATIKKYTSEVHL
TEDDLFDPDRKQPPRFVTQIKEQLTLTEMAKTKFECQLAPVGDPNMKVEWFFNGKPLLYK
NRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGMDETRAIIKVSGKPGIVYDSQLPA
HMQSIDRIREMEASWQVVPEEVDPDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGYPR
PRVMWLINGHTVVHGSRYKLTNDGMFHLDIPKTRQYDTGKVEVIARNSVGESLASTELNV
VARSDDYRNVLKNSPRPWYDYELAAYQKERQENELEKVFDERKQYLSEQSAHTLKGVEHL
KPKQYKPQTPDWQQNVKAKKSEEYYNKLQELETEQLLKETTLRRDNHQYAIPGEKVVSSS
AAKGMAQSYEENLQEQTSTTQIKAAPPKGTAQPSESSVHGREVHMNKQQQVQKEIQGDLE
ITRKITATETTEVEHKGTIQERVVKGPVKPSKAPVFTKKIQPCRVFENEQAKFEVEFEGE
PMPTVKWFRENFPIQNSPDLQIHTFSGKSILIIRQVFIEDSAVFTCVAENRGGTAKCSAN
LVVEERRRAGKGGIQPPSFVSTIQSTTVSTGQLARFDAKVTGTRPMDVYWLKNGMKVQPS
IKFKMLEEDNIHTLLIIEPFAEDSGRYECVAVNAAGEARCDGDCIVQSPTKPEKPTTPGS
EKAPHIVEQLKSQSVEEGRKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMTRQGEYYQ
LIISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRPIENLDAPPTITALKDVSVTEGMPAQ
FKTTVTGKVKATSVQWFREGQLIPETPDFQMIFDGNSAVLLIGTTYEEDSGIFTVRVTSS
TGQVESSAKLTVKSKD
NT seq 24351 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtcgtcaaacgttagactcatcgatgtcttcactgtactcggccagctcctcg
aatcgccagctccagctacagccacagtcgcactctcagtcacagacgcagctagacgcc
ttcaattattcagcaacaatgtcatcatcgtcgccaacgccaagccaggcaacgacgtcc
tcctctctgcgtgccaccacaattggcaccgttgtcgtacgctgtggacccatacagctg
gtgatagcgctcttgcaaagtcccgaaaagatttacatcaaagttgtggagctggagcca
aaaataacagcgctcggcgacaatctggacgagtcgctgcacatgcaaagggagcacgat
gagacgctgcgtaatctacagaacctgcctgggcccatggatgagttcgtgcagaaggcc
gacaaattgctggccagcaaacgcatcagctcggagctagtcaatgccatggccgacaca
ctgaacatcatttggcaggatatactgaatctgctgcaggatcgccagcacattttgcac
ctgtgcacacagtttcacgacaagatgacgcagtgcttcaggcgcatggatcagctggag
ggggcttgcaacgaggcgccgctgcccgccgaggtggctggcgttcaggagttcctcaac
aaatttaaacagctgcgcatcgacatgctgaccggcgtaatggcggcgctacaggatggc
aacgagctgctgtcccagctgcaggagttggagaagctcgagacactggacacacgaccg
gagcacatcaaacgcgatgcaactcgagctgtgcatcaggtgcagcagtggctggaagcg
ttgcacgatcgtcgcaactccctggagctggcctggcagacgcgcaaggcacagctggaa
cagtgtctggccctaaagctgcttggccgcgagctaatcgagctggaggcagcactgcag
caggccaagcacgagctgaacacaatgtacagcctgggcgagtgcgagcacacggccaat
cagacgctgctcaagtatcgggagtggaagcagcaggcgctgctgctgcgcgatcgtgct
ctcaagattacgcgcgccaaggagaaggttcaggcgccgggctactttgctggcgatgag
gattgcgctcgtgcctatgctgtgctcagcatctgcacagagcacctagatttggtggat
cagcgtgagcattggctgcaacagtcacgcgacttctttgccaaagcggagcatacgctg
agcgtgctggagaagctggaactggagctggccagcgtcaagctgccgcccaattcaccc
gaaagctatgccatgttcgccaaggtgtcgcgagacgtgcgcactttcaccgaggagccg
ctgcggctgggctatggcatactggacgaggtgggacgcacacagcccgagacacagggc
atcaaacgtgtgctggacgagctggagaaccgcaaggcgtacatcgagggcatctgtgcg
aacagcagcgaggatcatcagcgagtgcaacgagctctaaccgagtttctctcgcaacac
aacgagctgctcgcttggctgcgtgcctctggtcagctgcagctgcagcagagcgtgaat
atgggtcgcaatctgcatcaggccaaacagtttctgctgcagcatcatgagctaatgcag
gatctggaggtaagcaaaatgagcaactcgtagtggactttacttacccttacccttacg
ctcacacagattaagggcgagctgatcaatctgctgctggagtccattaagcagcatcta
gagtcgctgagcccgcagcagcgcttcgatgtggactccaaggccgaggcattgcacaag
cactggattgagctgaaggatctggtgctgaagcgcgtcgactacgtgtcgctgctcatc
gagttcttcgagcaggccaacgagctctctagtcagttcgatcatttgcagcgccagcta
ctgcaaacgcccgacgagcacaagctgcagttcctacaggccacatgggccaacattgcc
gccagctacgcggaactcaagtcatccggccagcgattcatcagcctaaaaattgtggat
ccatatctcgagacgaagccctcagtgcaggcagtggaggagacgctgaacggcttcagt
aagcggcaagtcgacgtgacgagcagtctggaaaattggacaacgaccattgcggaaaag
cgcgaagtagaatatctgctagagaaagtcatgagtgacaacgaggagactgtggccaag
agcacgcaggtggacacacagctgtatccggtgttcagcacatccagcttggactccaag
cagctgctgacgagcacacgcgagaagctcagctatgtgacacaggacatagagcgcgcc
caggaggagatacagcagcgcatacagacgacgctgagcatacagaccaaggatcagcaa
tcgctgaccaagatcgagcaggtgatcaacaatttgcgcatgctgaaggcgaaattggat
ggcatcaagtacgactatcgcacgctgctggagagcgtgctgcagttcctcgagaacatc
gtgcagctgcgccgagagatcgatgggtattttgccaaacagcagtcgagcgcgacgggc
ccatcttcgggcgtggagcgcaccatagccgagcatgagaaattccgcgatcagtgcatg
gataaatttagatcgttaatcacacaatccgaactgctgatcgatcgtgtgcgcgtattg
gagccaccgggcgctcgcgaaatcgacactgatcgcattttgaagttgttggagaatttg
cgcattcacttcgagtcgaatagcagcgccacaatgtccactctggagcgtctcgagaag
atcgagcagtttcgcagcgacctggaggatatcgatcgcagtctggacagcgtcagcaag
cagctgcacgatattaatggccagagtgtggatagtctagcagctgccaagactacatcg
ctggcattcgaatactttgaacgtaccatagagctgctcgagaagcgcatcgagaagttt
acagagaccacgagccagcagctgttcattagcaatcccgagagcgaagcgtatgtgaag
gacgagctgcgcaagctcaacgataaatggcagagcttcaaggatcaagtgaagcagaaa
cgaaagagcctcaatcaggctaacgagttcttcgaggtggtcgagaagatcgatgcggag
taccgcgagatcagctacttctacaacagcgtctccaataaggtgccctatttacgcgat
gccgtcgaagcctcgaatctggtaaatgacattgagaaatatgtgaccactcgagagcca
gcgctgcgctccaagctggacagcgcttcgcagtgtgcgcacgacatgaacaaggtctca
acgctctacaacgacgtgatgaatattttccaatcgtttatcaaactgaagacggacatc
aacacggtgcaggagcgtctgagccaggaacagcgtcagcgtgaccaacgggagcgcgag
gcacgcgctcaggccgagcgagagaaggcgattcgtgaggcagaggccagagagcgtgtg
gcacgcgaggagcaagcgcgtctggaggcgcaacgtcagcaggctgccattgagcaggcg
cagcgcgagctggcggccagacaattatcgctgcgcgagcaggcggtgcgggaggaagag
gcgcgtctgcaggccgtgcgcgaacaggcggccagggagcagttggcccgagagcaggct
gcgcgcgaggaggagcagcgcatacaaacgctgcgtgacatagccaagcgtgaggaggag
ctgcgcatgcaggcgctgcgcgatgaggaggcgcgtctgcatataaaacgcgaggaagag
ttgagaataaagcgtgaagaggagatccggctaaggcgcgaagaggagactaggctgcag
cgcgaagaggaggccaggcaaaagcgcgagaatgaattgcgcatacagcgcgaggaaata
acgcgcctgcaaacgctgcgcgatcaggtcgatcagcagcgcaccgtcacggagaacata
cgcaaagacattcaggtgaaccagattttcacggagctgcgctacgcctcgccgctgttc
gtgcgcccactgaaggatgcgttgacccgcgagggcgaacgcttcgtattcgaatgcgag
gtcacgggcacaccagagcccagcgtcgagtggttcaaggacggcatcagcattcaaagc
aatgcggattacaagaccagcttcgacaagggcatttgccgattggtcatagaggagacc
tttgccgcggacacggcacgcttcagctgccgcgcctccaatcttgtgggcacctgcgac
accaatgccacgttgacggtacgcgagaatgccgccgagctgcagctggtgccgccgcgc
atcctgcgcttcctggagagcggcaaggccaccgaaggcaccgccttccagttctcgtgc
gtggtcagcggtgtgccgctacccaccgtgcagtggttcaagaacgacaaatgcatcgac
gactcgccggactatgtgatcagctataacaatggcgaggccatgctgcgcttcgacgag
gtgttcctcgaggatgatgccgtctacacctgtagcgcctcgaatcccgctggcatagaa
cactgctcggctagtttgattgttgaaccattagaacccactgagctgccctgcttcaag
atgccgctccagaacgcaatggcgcgtgttggacagaaaatcaagatggaggccttggtc
accggaataccgcagcccgaaatctgctggctacacaatggcaaaccatttcagccacgc
gactcaaaatacgaaaacggacgcgttacgcttacaataccgcaagcttatccaaacgac
gccggatcctacgtgttgagtgctaagaacttggctggcgaagcttacagcagttgcaac
attattgtcaagggtcgtctgccaaacgagacgtccgattctgagatggctagcgacatc
gagcccatccgtccggcggtgcatattccgctgaaggacgtcttcatattcgagggcaag
ccagtgcgcttggactgtgtgattgtgggccagcccgagccggaggtcatttggtatcac
aatgagcgacccgtgaaggagtcggctgatgtgcagctgctattccagggcgatcggtgc
tcgctgttcatacaggaggtctgccaagaggatggcggcaactataaggtggttgccatc
aattcagcgggcgaggcttcgagcagttgtgatctgaaggtgacttcgctgaacgcggag
gcagcatctagagtgcagcttgatcggcaatctgtgcccaaggagtcgcagcccaaattc
gagcgtttgctctccgatgtgctgaccgatgagggcgagcaggtggtgctagaggtgcac
gccaacggcgatcaaccattgaaagctcagtggtatctggccaacaaggagctgcagctg
aacgaacgcgtcaccacgcagtccgatgccgaggctggcatattcaagctcatactgaac
aacgtggctgccagcgacaaaggcgtctacacggtcaaggtctcgaacaatgcgggcgat
gccaaatgcttctctcatctaattgtcaagtcagtgaatgcccctgagaatcgtcgcagc
agtcaatcatctgtggagatcgtcgagcgacagctgtgccccgagttcaaagagctcttc
agtgacaagcaggcccacatcgacgatgtggtcaagttcgagtgtattgtggtgggcaag
ccaacccccaaggtgcattggtttttcaatgatcagccggtgcacggtcacaatttcctc
gtctccaccagcggcgatcgtcaggtgttgacgattcagcagttaacgcacgatgccgta
ggcaagatcagctgcaccgccgagaacgacgcaggcaaagcaacttgtgtggccttcctg
aatatcattggcagcagcccagtgccagcctctagtaatttgcagaccatgacacaggag
cacaataccgaatcatcgcgtgtcaccatcaagaagcaaaccttcaccactacctccacg
tcgcaggtcaactcgtatgaaggcaacgcgccacagacagaggtacatcattcctcggcg
cacattgatcagtcgctgaagcagctgggacaacagcggcccgagattgttgagagccat
cactaccaggagctgcacaagagcaaaggaatgagcagccccgcggtgcaacagaagtcc
tttacgctggttcagtccaccaatggagctgcatcagtgccagcaattggtatgcccgag
tcgccaacgaggctgcgcagggagatagcgccacgtttcaccacaccactaacgggcaag
attgtggatcagggcgccaacgtgagcatggaggccatctatgacagctatccctcgccc
gagatcaaggtggagaaaaatggcgatcaactgttcgatactccgcacaccaagatatcc
aacaaaaacaatcgcgtgactattgaactaaaggacgtgagcgtggccgatgctggacga
tatgcggtgacagcctcgaacgcggcgggtcagtcaacaagcacagcggatctggtggtg
aaaaagaccatctttccgccagtcttcggtcgtcgtttgcaggcgcaggttagcagaaag
ggtgagcgattgattatggaggtagaagtgactggactgccagatcctactgtcacctgg
ctaaaggatgacataccactccaggatgctggcatctctgagcatcgcctgcttgcccag
ggcaactcgtacaagctgatcatcgagaaagcacatacaacggactctggcaagtatatg
gtgagagcaacgaatgctggcggcgaggccaagagcattgcggactgcgtcatattggag
ccatcgccagaacgcatgcaggaggtggtcaagaccatcgtctatgaggcgccagccagt
gaattcaaaactgaaagccacttcaacaaagagccccaatcctatcagaccaatcaaacc
gatgaaaccactgccaacgatctgcatggcctgtccgagtcgaaagtaatcactgagcat
cgttgcaccactgaggcaacgatgcgtctagagcacaaatcgacatatcaagacctgccc
gagctgagtcagcgaccaaagacaccaaccaccaacaccaccaacaccaccaccactacc
agtaccaacaacactgccagcatggaccagaccgatacacagaccagttataagactggc
gtcacacaaaccccgccgccagtgccacccaagccctgtgcgcccgttgtgggcacggct
tttggccagcaggcgcaggcgcagccacaaccacaacaaccaccgcagatgcagacgcaa
atcaacaccagatacgagagcagcagcaacgaacacaaaatgtcctcatcctttgagtac
ttcaagaagatcgatgaggaaaccgtgacacaacgacccaaaccacaggcgcaacggccc
ctagagacggtggtgcgtcagccgcaagcgcaaacgctggccgaggagctgagaagcttg
aatcttataccaggagcaccgccagaattttgctatacgcccaaatcggagaagcaacta
cccaagcagccgctcatccacgagaaaatcaagattttggaggaagtgcagcccagagag
ccaccaccacagggtggtgtgcccgtctttccaccacctctaaatctgcagagtgtgcag
cacgagacaactctcaccaaggaggtcaaggtggagtatggacagccaattgtgcgcccc
gcagcggtgctagccacgccggcccaacagaacacgcgctcgccgtcgcccaagccttcg
gctgagggcgtggctatgtctaagctgtggactcccagtggcacagctggctatacgagt
gatgtggagcagaagacagagcaccaaataagcatcaccaagcttcccacgcccacgccc
accaaggagctaaatgcgcccttcctggtgcagcaggtggctaagaatatcacgccaccg
actccggcgccagtcacgcgcctggtcaccgttgagcttgagcctggcactccgcccgag
atttgctttgcgcccaagcaagaggaagtgcgtcgtcattcgttggtggagagcatggag
cagaaactggaacagaatctcatgcagggtcccagcaaggtgctgccccattcggtgccc
acgttgacgcccgtcacggcacccaagtccaatggcaccaccagctaccgcccgccaccc
cccgtgatgcccaaccgcctgggcgcccactatgagagtgactacgagagcgatcgctac
aagtacagcggcagcgagtccgacgagccgggcaatcgcgcacgccagcagcaggccacc
atggagtcgtcgttcaagtcgagtggctatgcggccgatacggaggagcactctagctat
cgcaagtccgagagcagcttctatgagactaaatcatcgacaacaacaaacccgcctgca
gcagccaagctgcagcccgagccgccagcacagctgtactttgccccaccagcggcgcca
cagcaaactagctacagtcaggaggcgaagaattacaagtacacctcgtcgagcatgacg
agcaatatgcagcagagcagcagcagctccacacatcacgagaccaagtattcctcgaat
gccacgccgctggtcacgcccagcccagtgccggcgcagcgcaagacgcccgctgcggag
ttcagcgactacagcagcgaggtggacgagcgtttccgttcggtatcgcgagccaatgaa
tccgactcggacatcaagggctatcgcgtggtgtttccaccaactcccacgccgcgcacc
aacatcgccaacggtcacaagtcgccggtggtggtggtgacgccatcgcccatggagttt
gagccgatgccaccgcaagtgggcagctttaggcgtcccaaattcgagcccattggcaag
gagatacgccacgagatcaaaaccgagagcagctccaagcagtactcgagcagtcagcag
cagcagcagcaacaaccgcagcccgtcttcaagcccaagccggtggcggccaagtttata
gccgccactcagcagcagcagcagcagccgctgccgagctcacggccgaccatgtactac
aatgcagttgccgggacgccaatgcacatggctaaggtggcccatgagacgaagaatgtg
atgcagatgcacgagtctacggagagctctcagcgtgttgtcaacatgcagcagaccaag
cgcgtcatacactttgacaaccaacaccagcaacagcaacagcagcagcagcagccagct
caggagccttttccttacagcccggcgggcagtcgcacgccgtcgcgtcagtcgcatctg
ccaccaccggccacgcccaccaagttcatacctggcgagtatcgggagagtgactacgag
agcgaagtagaaggcacacgcattcagccactctggtcgccgtacggcgatggcctgacc
aagggctaccgtcgtgtggcagcaccgcagtctggaggccgctcctgcagcttgccacgc
agttacgagcgcgtgctctcgcccatggagttcgatcgtggcccggagatgcctagcaag
atatttgtggatgtgagtacactgcgcaaggagcagcgtggcggcagcactgtgaccaca
caacatcgcacgcagtcgctgaatcgcaacagcaccttgaggcagcaatttggcaatcgc
ttgccggatgggtcgcaggatcagacagatctgcagcagcagcagcagcagcgatcgggc
acgttgcctcgttatggctacagcacactgcagcagcaggcagagggtcagggcaagcgt
atgggctcctcgttcctacagaagtcgcatcagttcatcgaggatgtcagcagggacatg
cagagccagcagatcagctcgaatggcggtctgcgtccaggctttcggcgtgcgccaagc
gagggcagcaatcaaccgcaggcctacagagatgagtcgcgagtgtcgcaatacgtgcaa
caacatcaaggcggtatcggaggcacctatgtaccgccctcgttgacacacgtttatgcc
caaggtgacatctcaccgcctgtattcgagcaaatctttaagaacgctcgcttcgctcag
ggtggcaacgccctgttcgaaggtcggctgcgtggcaacccgaagccattcgttacatgg
acccgaaaaggcgcaccacttctcgagtcgcaaaagttccgaatgagctacaacgaggcc
accggtgatgtgtccctgctgatcaaccagatcggacccggcgacgagggcgagtacacg
tgtacggctcgtaatcagtacggcgaagctatctgcagtgtctacattcaaccggaaggc
gccccaatgcctgtactgcagcccatccagaatctggagaagaacatctactccaatggt
tattcgtatacgtccattgaggaggaattccgtgtggatacgtttgagtatagacttttg
cgcgaagtctccttcagggaggccattacgcgccgctctagctatgagcaggacactcag
ctgtcccatgagctcgaccgctctcttggccctgcgcacgcaccacaaatatcgcagaag
ccgagaagctccaagctcatcgagggctctgatgctgttttcacagcccgcgtgggctcc
aatccgaaaccacgtctcacctggttccacaacggacaacgtttggtagcctcgcaaaag
tatgagatctcttattcaagtggcgttgccacactgcgcgtgaagaacgccaacgccaag
gacggcggccactataccctcttggctgagaatctgcagggctgcgtcgtctcctccgct
gtgctcgccgtcgaaccggcagctgaaactacctatgagcccaagcccgtggatatgatg
gctgagcagctggaagtcggcaaggctttgccgcccacttttgttaaggccttcaatgaa
cgcgaagtcaccgagggacgcatgacgcgtttcgattgccgtgtaactggcaatccctat
cccgaggtattctggtttatcaacggccgccaagtgcgggacgacgcttcgcacaagatt
ctggtcaacgagtctggcagccattcgctgatgatcacgaacgtgagccgcttagatggc
ggctctgttcaatgcttggcccgcaacaaggctggtgaggtggccatcgaggcgccgctg
catgtgctggagaaggagcaagttgtcgcaccacaatttgtgcaacgcttcagcacgatg
acagtgcgcgagggtgagcccatcagcatgagtgccaacgccattggcacccctgtgccg
cgcatcacctggcaaaaggacggagttcaaatctcatcaactgctgaacgctttgtgggc
atcgatggcggcgccacctgcctggagataccgcaagttaaggcaaccgatgctggctgg
tatcagtgtaccgcacaaaatattgctggttctacagcgaaccgcgcaagactctatgtc
gaagttcccagagagcaaccaagtcaagaacaaaggcgtcttaatcttccaagaccaacg
aaagttatcgagcctgagccaatccctgggccagaaattatttatttgcgccatgtggaa
cgcgccaaaccccatctgcggcccggcgaggaggatcgtgtttatcctccaccacagttc
atcataccactgcagaatgtgcagcagactgaaggtggtcgagttcacatggaggcgcgc
atcgaacccgtcggcgatcccagcatggtcgttgaatggtatctcaatggtcgtccacta
gcagctagtgcacgcgccacgtctgtcttcaagtttggcttcattgctctggacttactg
agcatcatgggccatgattctggagaatatatgtgccgcgttagcaatgccagcggcgtg
gcagagtcgcgcgccattttgtcggtcgtgcagcgaccttccattgagcaatcgtcgcag
aatccgaacagcttgcagtatatcaatcagctggaggattactcccgctatcagcgccag
gagagctcagaggagttgatgaatcaagctccacaattcatacgtccattgcgcgatctt
ggtgaattcgaagagggcaagaatgtgcacttcgaggcacaagtgacgcccgtgaatgat
cccagcatgcgtgtggagtggtacaaggatggcttgccaatcaccgccagctcgcgtatc
acggctatattcaacttcggctatgtctccctaaacatattgcacctacgcgccgaagat
gccggcaactacaccgtccgtgccgttaatcgcattggcgaggccatcagccagtccacc
atacgcgtgcactcgcgctcccaggtcaccgccgatctgggcatacccgaacagcagcgt
tacattgagaaggttgaggaattggaagactatcgcaagtctcagcagcgtcgccatgtc
caggaggcgcctgaggccattgcacctccccaattcaagacaccaatccagaaccaactg
gatctgcgtgagcacgcgcatgcgcacttcgaggcgcgcctggaacccattggcgatgct
accatgcgcgtggagtggctcaaggatgggcaaccgctggaggccagctcacgcatcaca
acttatcacaactttggctacgtcgcgctgaccatcaaacagattaccgtctacgatgcc
ggcacctacatctgccgcgcctacaatgccatgggtcaagatacaaccacggcccagttg
acggtcgtatcgaagaacgagatcgtctcggacacgcagcatccgggtggtctgcaaaag
attcaacatctggaggactcctcgcgttatggtcgccgcgaagaagaagaaacgtccata
acacaggcaccgcgtttcctgggccctctcaagggaaccaccaagatcttggagggtcaa
cgtgcccactttgaagcccgtgtcgagccacagagcgatctgggcatgcgcatcgaatgg
tatcataatggacgcgccatcaccgccgccaatcgcatccagatgtactacgatttcggc
tacgttgccctggatatttcccaggtgcgcgctgaagatgctggcatctacactgtggtg
gctagaaacaagctaggtgaagctcagttgcaagcaacgatggtagtggaaactcgttcc
aacatcgacacatctagcatgcatcgcggcctatatgaaaaaacccagaacctggagaat
aagcaattcgtagagcctcagtatgatattgaggagatctccaagtcaaagcccgtcttt
gtgcagcctctgaccgaccccaagcccatacacgatggcaagaatattcatctggagtgc
cgtctggaacccatgggtgatcctactatgcgcgtcgaatggttccacaacggacgcccc
gtaaccgttggctcgcgtttccgcacctattacgattttggtttcgtcgccctggacatc
atccaggccacggcagcggactccggcgagtatactgtgcgcgccaccaaccatctgggc
accgctcatacctcttcttgtgtgcgtgtgattgatcgcaccgatgtggtgaccgaaacc
cagaacgagcagtcgctcgagcagattcagctgcttgaggattcgcgtcgtcgtcaccat
caagaagaggatataaccattatgcaggcgcctcaatttacacgcgcgctgcataacatc
gagaccgttgagggcaccaatgtgcacttggagtgccgcctgcagccagtgggcgatccc
agcatgcgcatcgagtggttcgtcaatggcaacccggtaaagacgggccatcgtttccgt
cccgcctacgagtttgactatgtggcgctggacttgcttggctgctatgccattgactcg
ggcgtctatacgtgccaagcccgtaaccagctgggcgaggccgtcacctcctgctccgtg
cgcatcattgctaagaaagatttgattctggaaacccagaacgagtctggcctgcagaag
attcaatatctggaggacacctcgcgctatcgtcgcaatgagtttgtggatgaggtggtc
aacattcgccctcgcttcctaacccatccgaagagcctgaccaacactcgcgaaggcgcc
cacgcccactttgagtgcaaaattgaaccagtcaccgatcccaatctgaaggtggaatgg
ttcaagaacggtcgtcccatcaccgtgggccatcgcttccgtcccattcatgatttcggc
tacgtggccctagacattgttggcctgattgctgaggactccggtgtctacacctgccgc
gccgtcaacttgattggttccgatgagactcaagtggagctgcagtgccgcagtggcgag
caaattgtcaccgtcacccagaacgaggctggtctcgagcagattcactatctagaggat
cgttcgcgctatagccgccgcgaggaagtcgacgagagcaccaagcaggcgccagtgttc
accacctcgctgaagaacattgagatcaaggagaatcaacgtgctcactttgaatgccgt
ttgattcccgtttccgatccatcgatgcgtgtggaatggtaccataataatatgcctctg
aaatcgggctcccgtttcaccgagaccaacaactttggcttcgttgccttggatattatg
tccaccctgccggaagatgccggcacctatacgtgccgtgccttcaatgcagtgggtgag
gccatcacctcagctgtagccgtggtgcacactaagaagtccatttatctggagtctcag
cacgagactgcattgccgcgactgcagcacttggaggatggctccaaacgccaacgcgtc
agcctacaggacgagttcgtctcgcaggctccggtcttcaccatgcccgtgcgcgatgtt
cgtgtagccgagaaccaggctgtgcactttgaggcacgccttattcccgtgggtgatcca
aaactcacggttgaatggctgcgcaacggccagcccattgaggcgtccaatcgcaccacc
accatgcacgattttggctacgtggctctgaacatgaagtacgtgaatcccgaggattcc
ggcacctacacctgccgtgcagtcaacgagttgggtcaggctgtgacatcagcctcgctg
attgtgcagtcaaagacggccattcagttggagacgcagcacgaggctgccatgcacaag
attcatcagctggaggatcacagcaaataccagcgccgtgaggaggaggaatattccgtt
acgactgcgccaatgtttgtcaccaagctgatcggacccaccaatctggttgagggccag
agtgcccattacgagtgccgcattgaaccttatccagatccaaacctgaaggttgagtgg
ttccacaacggcaagcccttgagcaccggccatcgcttccgcaccacctacgacttcgga
tttgccgcgctcgacatcctcaccgtctatgcggaggacagcggagagtatacttgccgc
gtcaccaacaatctgggcgaggccgttaactcgattgcactcaatgttacttcccgttcg
tcgattattcatgacacccagcatgaggaggcgctgcataagattcagcatctggaggac
gcctcgcgcttccagcgcaaagccgaagaggatcagttccacgctgagcgtccgcagttc
ggacgcccactgcgtaatgccaaggtcaacgaaggcacacctgtgcatctggaggcaact
ctgatcccagttaatgatcccacaatgaaggtcgagtggtactgcaatggcagacctatc
caaacgggtcaccgtttcaagaccacctacgatttcggttttgttgccttggacatcctg
tatgcccacgccgaggataccggcacctacatgtgcaaggccaagaatgctgttggggaa
gctgtcacgacttgtgctgtaaacgtaacagcaaacaagacactggatctggatacactc
gatgcccagcggctggagaagattcgccagcttgagagttatgcgccacccacaaaggcc
gaggtggaggagaagggacagaaaccaatcttccttaccccacttagcaatctggagcat
ctgaaggagggtgagcacgcacacttggagtgtcgcgttgagcccatcaacgatgccaat
ctgaagatcgaatggttctgcaatggcaagcaattgcccactggacatcgttatcgcacc
acccatgacttcggctacgtggccctggacattttgtatgtttatggcgaagacactggc
acctacatgtgcaaggctaccaatctcctgggcgaagcagtgaacacctgcaatgtccgc
gtgcttaacagacgcagcatgattctggatacccagcatccggatgccttggagaagatt
cagaagttggagtccaaggtagtcaccacccgcactgaagtcggcgatcatccaattgga
ccgccacacttcactgccgaactgcgtggctctactgagatctacgagggacaaacggcc
cactttgaggcgcaggtggcgccagtgcatgatcccaacttgcgcatcgagttctatcat
aatggcaagcctctgccatcggctgcccgcttccacatcacctttgacttcggctacgtg
tccctggacattacccatgccgtggctgaagatgctggcgaatattccgtgcgtgctgta
aacgctttgggtcaagccgtctcttcaaccaatctgcgcgtgattgcccgcggcaccatt
atttcggacacacagcatcctgagggcctggagaagatacgcaaattggaatctacggca
ccgcaccagcgccaggaggtggaaacaccgggcacacgccagcgaccagtgttcacccag
ccgcttcaaaatattgatcgcatcaatgagcaccagacagctcactttgaggcgcgtctg
atcccagtgggtgatcccaacttgaaggtcgaatggtaccgcaatgagaagttgatcgag
gacagttcccgcatcaccaagcaacacgactttggctttgtttcgcttgatatatcgcac
atccgcaaggaggatgagggcgtttacatgtgccgcgctgtcaatcctctcggagaggcc
gttaccaccgcttccatgcgagtagttactgaggccaccatccaaatggatactcagcat
ccggacagcattcgtcgtatacatcagctggaaaagcctctggctccacttcccaccgaa
cctgagcgcctcttcgaaaagcccatctttacgcagctgcttacgggaccctccgaggta
tgggagggtgctcacgctcactttgaggcacgtgtggtacctgtgggcgatccctcactt
aagttcgagtggttcgttaacggcgttgagctgcaaatgggctcacgtctgcgcaccaca
cacgactttggctttgtcacgctcgacatcgccgctgtggtgcctgaagacgctggtgtc
tacatgtgtcgtgcttacaatgctgctggcgaggctgtgtcctctacggccatgaaggtg
aagaccagagccaatattgatggacagcccttgatacccgagtcctgggaggccattcgt
ctgaaggaggccgctatgaaccgtgtgcccgaaatgtttgtggactctactcctcagcaa
gcgccagtgttcactacgcacttgcagagctacgacaaattgcacgagggtcaacatgtg
catctggaggctcaggtggagccacgcgctgatcctaatctgcgcatcgaatggttcaag
aatggcatctcactgaccactggctcacgcatacgcagcacctttgactttggactagtg
accttgtccatcaatggcttgcgcgaggatgactccgctatttacacctgcaaggcaacc
aaccaggtgggcgaggctgtgtcgacttcatcactcaagatcgaagatcgtccttggcta
catgcggagtccctgcatccggactcactgccacgcattggcgaactggaggcacctaag
gaaggccgtaaagatgcacctgagcccacttatgagactcctgtgtttatcacacatctg
aacaacattgagtgcaaggaaacggacagcgtgcgctttgagtgcaacgtggagccagcg
cgtgatccaaccatgaatattgaatggttctacaatggacaattgttgcaggcagctgcc
aaattcaagtctatctatgactttggctactgtgctctggatctgaacaattcgtatgca
gagaacagcggcatctacacttgcaaggccacaaacagcaagggctcggccactacttct
ggcactctgaaatgcacaggcggcaagaccatgttcttcgacactcagcatccacagggt
gagagcggccttgaagccgtgcaggagacggaagaagcattggccaatcgctatgcccag
aaaccaagcaaacctgaaactcaatacccaccgccggtatggaccaagccattgcagcaa
gagttccatctaagtgaggcgcagcccatccatttggaagccaacgtggaaccgaaagag
gatccaaatctgttcatcgaatggtatttcaacggcaagctgctgcagcatggctcacgc
ttcaagatgaccagcgaattcggattcgtcactatggacatgattgaggtgtactccaga
gatcagggcatctacacttgcaaggcctacaacaaggctggcgaggcgttcacatccacc
actattttctgctcaagcaaggacagcatcattgaatccacgcagcatcccaagggtgcc
gagggtctggagcaaattcaggatttggaggattctctacgcaaggatggcagcaagcct
gagcagccagaacagggcattgcaccacgcttcaccaccgaattcgttaacattgtagac
attggcgaaggtgagttggcccattacgaagccaatctcattcctctgggcgatcagagc
atggtcattgaatggttcttcaatggcaaagttcttgaggccagccatcgcgtgcgcacc
atctacgcctttggcaccgtcgctctggaagtgctgggcaccaagatcgaagacaccggc
acctacacctgccgtgccacaaacaaatatggctcggctgagatcagctgcacattggag
tgtgttgagaagcctcgaggccagaagcctcacttcacgtcgcacattcagccgctgcag
ggcctgaaggatggccaatctgctcactttgagtgcaccttgattccggttaacgatccg
gacctcaaggttgagtggtaccataatggcaaactgctccgtcactcaaatcgcatcaag
acggtctccgactttggctatgtggtcctggatattgcctacctgcaggatcacgacagt
ggcgagtacgtttgccgcgcctacaacaagtatggcgaggacttcactcgcaccactctg
aactgtggtggacgcggtggcgtattctatgacagcttgcagcctgattctctacagagg
attcgggagctggaatgcccgcaaggacagcaagcggataccggcgctccagtggttgcc
gaaccacccaaatttatcacacaaatcagcgatgttaccaagttggtggaaggccagagc
gctcactttgaggcccgcctgacgcccattaccgatcccgacttggtggtcgaatggtat
ttcaatggcaagaagctgccacatggccatcgcttccgcactttccacgactttggcatt
gtcatcttggatatcctgtattgttatgaggagaactctggtgtctatgagtgccgcgct
tacaataaatatggcgaggacgtcacccgtgccacgctaaagtgcgcatccaaggccagt
ctgatcttggactcccagctgccacgtggcatggaaggtggcctggagaagattgccaat
ctggagtacagcatggtacgcacccgcgaggagaccaccgaggaaaccagaggaaaggca
cctgtgtttactgtgccgctggagaacatagacaacctgcgcgagggcgagaatgctcac
tttgaggctcgcattacgcctgctgacgatcccaagctgaaggtagagtggtactggaac
ggccgtccactgaaggctggctctcggttccgcactttctgcgatttcggctttgttatt
cttgagatttcgcctgtctatcccgaggattctggtgaatactcgtgccgtgccatcaat
gagtatggagaggctgtgaccaccgcaacaatgaagatccagggcaagcgtagcattatt
atggaatcacagctgcccaagggcatggaaggaaccatcgatcgcattgctgaattggaa
ggcctgggctctcgtagcacagagtttgtgcccgaagacgataccggcaagccacctgag
tttattacaacgccgttcgacatggtcatcggagagaactcgctggcccacttcgaatgc
cgtctgcagcccattaacgatccgtccatgcgcgtggattggttccacaacggcaaggcc
ttgtgggccggctcccgcatcaagaccatcaatgactttggctttgtcatcctggagatt
gccggctgctatcagcgcgatacgggtctgtatacctgcaaggcgaccaacaagcacggc
gaggccaccgtgtcctgcaaattgcaggtcaagggtcgccagggcattgtcatggagccg
cagctgccctcgaacttccgcactggcactgagagcttgcaaaagctggaagagagcatg
cacaagcgggaggagattgtcatcgacgaggagcaaccaaatccacccaaattcattgag
gacatcaaggataacttggacgtacccgaaggtggaccaattcacttcgactgccgcgtc
gagcccgtcggtgatccaacaatgcgcattgaatggtactacaatggacgtgtcatggcc
actggatccagagtgcatcaactgaacgactttggcttcattgctttggatattgactac
atctatgctagggactctggcgaatatacttgccgagccactaacaagtggggcagtgct
accaccactgccaaggtcacctgcaagggcaagcacagcattgtctacgactcacagctg
cctgagggcatgaccgccgaaaagttgaaggaactggaacgtggacgcataccagaggcg
cccaaggttgtcgaagagcagtttggaccaccgaaattcatcacacaaatcgcgtcctgc
acagccgaggagtctgaagctgtgagattcgaatgtcaagtggagccaaagaccgatccc
aatctgcgtgtcgagtggtatcgcaatggcaagcctctgcccttgggtcatcgctataga
aacgtcttcgacatgggcttcgtctcgctggacattttgtatgtgtacagtgacgactct
ggtgaatacgtttgccgtgctgtcaacaaatacggcgaagatcgaaccaaggccaccgtc
tcgtgcaagaaattgccgacgattttgctgcaaaatcaggtgccacgtggcatgaagcgc
tcggaaacgctcacccaaatggaggccaccatcaagaaatacacctccgaggtacactta
accgaggatgatctattcgaccccgatcgcaagcagcccccacggtttgttacgcagatc
aaggagcagctcacattgacggaaatggctaaaaccaagtttgagtgccagttggcgcct
gtgggcgatccgaacatgaaggttgaatggttcttcaatggcaaacccttgctctacaag
aatcgcttccagcccatttacgattttggctatgtggccatgaactttggctgggtttat
cccgaggacagcggtgaatatgtttgccgtgctacaaacttgtatggtatggacgagacc
cgtgctataataaaggtatctggtaagccaggcatcgtctacgactcccagctgcctgcc
catatgcagagcattgatcgcattcgcgaaatggaagcttcctggcaagttgtaccagaa
gaggttgatcctgatgccaagcccagaacgaagcctgttttcgttagcaagctggaacca
cagacggttgaggaaggcgatccagccaggttctgcgtgcgtgtcacaggatatccacgt
cctcgtgtcatgtggctaatcaacggtcacactgttgttcacggctctcgctacaagctg
accaacgatggcatgttccatcttgatatacccaagacgcgtcaatatgatacaggcaag
gtggaggtaatagcgcgcaattctgtgggcgaatcacttgcttcgaccgaactgaatgtt
gtcgcacgctccgatgactatcgcaatgtgctcaagaactcaccacgcccgtggtacgat
tacgaactagcagcctatcagaaggagcgtcaggagaacgagttggaaaaggtattcgat
gaacgtaagcaatatttgtccgaacagagtgcgcacaccctgaagggcgttgagcacctg
aagcccaaacagtacaagccccaaacacccgactggcagcagaacgtcaaggccaagaag
agcgaggagtactacaacaagctgcaggagctggaaaccgagcaactgctcaaggagacc
acgctgcgcagagacaaccatcaatatgccattcccggtgagaaggttgtgagcagctca
gctgccaagggcatggcacagtcttacgaggagaatcttcaagagcaaacgagcaccacc
caaatcaaggccgcaccaccaaagggtacagcgcagccctccgagtcgtcggtgcatgga
cgcgaggtgcacatgaacaaacagcaacaagtgcagaaggagatccaaggtgacttggag
attacacgtaagatcactgccaccgaaactaccgaagtggagcacaagggcaccattcaa
gagcgcgttgtaaagggccccgtcaagccctctaaggcacctgtcttcaccaaaaagatt
cagccatgccgcgtctttgagaatgagcaggccaaattcgaggtggagttcgagggcgag
ccaatgccaacggtgaaatggttccgtgaaaacttccccatccagaactcacctgacctc
cagatccacacgtttagcggcaaatccatattgatcatacgccaggtcttcattgaggac
tcagctgtatttacctgtgtggcagagaatcgtggcggaactgccaagtgcagtgccaat
ttggttgtggaggagcgaagacgcgccggcaagggcggcatacaaccaccaagctttgtg
tccaccatccagagcaccaccgtgtccactggccagctggcacgcttcgatgccaaggta
accggcacacgccccatggatgtttattggctgaagaacggcatgaaggttcagcccagc
atcaagttcaagatgctggaagaggacaacattcacaccttgctgatcattgaaccattc
gctgaggactctggccgctatgagtgcgtggctgtcaacgccgctggcgaggcacgttgc
gatggcgattgcattgttcaatctcccaccaagccggagaagccaacaacgcccggtagc
gagaaggcgccacacattgtggagcagctgaagagccagtccgttgaggagggcagaaaa
gtgatcttccgttgccgtgtggacggcaagcccacgcccacagcacgctggatgcgtggc
gagaactttgtgaagccatctcgctacttccaaatgacgcgtcaaggcgaatactatcag
ctgatcatctcggaggcattccccgaggatgagggcacctacaagtgcgtcgccgagaac
aagctaggcagcattcagaccagtgcacagctcaaagtgcgtccaatcgagaatctcgat
gctccaccaaccatcacagcgctcaaagacgtctctgtcaccgagggcatgccagctcag
ttcaaaaccactgtcaccggcaaagtaaaagcaaccagtgtgcagtggttccgcgaggga
cagctgataccggaaacacctgatttccagatgatctttgatggcaacagtgccgtgctt
ttgattggcaccacctacgaggaggattcgggcatctttactgtgcgcgtgacatcgtca
actggacaggtcgagtcatcagccaaactgactgttaaaagtaaggattaa

DBGET integrated database retrieval system