KEGG   Drosophila hydei: 111596480Help
Entry
111596480         CDS       T05888                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dhe  Drosophila hydei
Pathway
dhe00010  Glycolysis / Gluconeogenesis
dhe00562  Inositol phosphate metabolism
dhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111596480
   00562 Inositol phosphate metabolism
    111596480
Enzymes [BR:dhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111596480
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111596480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111596480
NCBI-ProteinID: XP_023166505
Position
Unknown
AA seq 221 aa AA seqDB search
MFYARSFNAEPAMQSAVAHVRAVTKLMDLTPQDVQLMYTVCAFETAWQRRRAPSVWCRFF
DVASLSALEFAEDLKYYWNDGYGYELTHRIACPAIADMFAAIDTLQPRANATFYFTHSGT
LLKMLAHLGVAKDERPLTHKDFEMKRLWRTSEIDAFATNLAFVRYNCIEREPQVLAMHQE
RVIRLPGCPQDEDLCPLSTLRANYADSVERCDFEALCQAAN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttttatgcacgtagcttcaacgcggagcccgcaatgcagtcagcagtggcgcatgtg
cgtgccgttaccaaattaatggacttaaccccccaggatgtccagctaatgtataccgtg
tgcgccttcgagacggcctggcagcgccgtcgagccccgtccgtctggtgtcgcttcttc
gatgtggcctcattgagcgccctggaatttgccgaggacctcaaatactattggaacgat
ggctacggctatgaattgacgcatcgcattgcctgtccggcaatcgccgacatgtttgcg
gccatcgacacattgcagccgcgcgccaatgccaccttctactttacccattcgggaacg
ctgctcaagatgctggcccacctgggcgtggccaaggacgaacgtccgctcacgcacaag
gattttgagatgaagcgtctgtggcgcacaagtgaaatcgatgcgttcgcaaccaatctg
gcctttgtgcgctataactgcatcgaacgagagccgcaggttctggccatgcatcaggag
cgggtgatacgtctgcctggctgtccgcaggatgaggatctttgtccgctgtcaacgctg
cgtgccaactacgcggatagcgtcgagcgctgtgactttgaggcgctctgccaggcggca
aactga

DBGET integrated database retrieval system