KEGG   Drosophila hydei: 111597483Help
Entry
111597483         CDS       T05888                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
dhe  Drosophila hydei
Pathway
dhe00071  Fatty acid degradation
dhe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111597483
Enzymes [BR:dhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111597483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 111597483
NCBI-ProteinID: XP_023168002
Position
Unknown
AA seq 675 aa AA seqDB search
MFRLKVNKSRFAAAAAATRHATTTTTHGNHYQYLQNSKLPTLYFQRSLPRLPIPLLEKTC
ERFLASVQPILSAEEHRETQQVVEQFRQGIGMELHAKLKQRDAANKHTSYISQPWFDMYL
ADRVPLPLNYNPLLVMRGDPRPEYQPQVTRATNLIISSLRFWRSLQANILEPEVYHMNAK
KSDTASYRRWMAVAPKAFATYASYAFKAFPLDMSQYSRLFGTSRIPKLGKDELVQSPQSK
HILVMRRGNMYAMNVLDTSGYIESPSVILGRLKYILETDSQREPASVPLGVLTTSQRDEW
AKTRAHIISNPKNADLLQREVDAALFCLCLDSEEDGLFNESDPVPMLKHQLAGKATNRWF
DKSISLLISADGVTAINFEHSWGDGVAVLRYFNEVYRDMLNQPFVSESTPHTPANGDCTN
VRPLNFEIDNGTQAAVEAAYVQNASIVDSLDMNYLQYKLLNKGTCKRHGLSPDSIIQLAF
QLAYRQAFERYVGTYESCSTSAFRHGRTETMRPCTMATKAFCEAVLQPTQKQPSAGELRA
MIDRCSSVHGQLTKEAAMGQGFDRHLFALRHTAQLEGLSQPALFETEAYKRINNNIISTS
TLGTDTVVAGSFGPVVKDGLGVGYSIQNDFAGAIVTSYKNQAEGKKFIDSLESAFDQICA
IIERSSLSAKAELKN
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtttagattaaaagtaaataaaagtcgatttgccgctgctgcggctgcaacgcgccat
gccacgacaaccacaacgcatggtaatcattaccaatacctgcaaaactcgaagctgcca
acgctctactttcaacgttctctacctcggttgcctataccgctgctggaaaaaacctgc
gaacggtttctggcctccgtgcagcccatactcagcgctgaagagcatcgagagacgcaa
caagtggtcgagcagtttcgccagggcatcggtatggagctgcatgcgaaactgaagcag
agggatgcagccaacaagcacaccagctacatctcacagccctggttcgacatgtaccta
gctgatcgggtaccactgccgctcaactacaatccgctattggttatgagaggtgacccc
cggcctgaataccaaccacaggtgacgcgtgccacaaatttgatcattagctctcttcgc
ttctggcggtcgctgcaagctaatattcttgagcccgaggtttatcacatgaatgcgaag
aagagcgacacggccagctaccgtcgctggatggccgtcgctcccaaagcctttgccaca
tacgcttcgtatgccttcaaagcctttcccctggacatgagtcaatacagtcgtctattt
ggcaccagtcgcataccaaagctgggcaaggatgagttagtgcaatcgccgcaatcgaag
cacattcttgtcatgcgacgcggcaacatgtatgctatgaatgtactcgacaccagcggc
tacattgagagccccagcgttatactgggtcgtttaaaatacattcttgaaacggattcg
caacgcgagccagccagcgtcccattaggcgtgctaaccacctcgcaacgtgatgaatgg
gccaagacaagagcacatatcataagcaatcctaagaatgccgatcttctacagcgcgag
gtggacgcggctttgttctgtttatgtctggactctgaagaagatggtctctttaatgag
tctgacccagtgcccatgctgaaacatcagctcgcgggcaaggcaacgaatcggtggttt
gacaaatccatatcactgctgattagcgccgacggcgtcacggccataaattttgaacac
tcttggggtgatggtgtcgctgtgctccgctacttcaatgaggtctacagagacatgcta
aatcagccatttgtttcggagtccacgccccatacaccagctaatggtgattgtacgaat
gtccgtccgctcaactttgaaatcgataacggaactcaagcagcagtggaagcagcttat
gtccaaaacgcaagcatcgttgatagtttggacatgaattatttgcaatacaaattactt
aataaaggcacgtgcaagcgacacggtctgagtcccgattccataatacagcttgctttt
caactggcctatcgtcaagcatttgaacgttatgtgggaacctacgaatcctgcagcaca
tcagcctttcgccatggccgcaccgagacaatgcggccctgcacaatggctaccaaagca
ttttgtgaggctgtactgcagccaacgcaaaagcagcccagcgccggggagctgcgcgcc
atgattgatagatgcagtagcgtgcatggccaacttacgaaggaagcggcaatgggtcag
ggctttgatcgtcatttgtttgctttaaggcacacagcacagctggaggggctgtcgcag
ccggcgctatttgagactgaagcttataaacgcatcaacaataacataattagcacctcc
acgctgggcactgataccgttgtagccggttcattcggtccagttgtcaaggatggcttg
ggcgttggatactccattcaaaacgattttgctggcgcaattgtaacctcgtataagaat
caggctgaaggcaagaaatttatagatagtctggaatcagcattcgatcaaatatgtgct
atcattgagcgcagtagcttgtctgccaaagccgagctaaagaattaa

DBGET integrated database retrieval system