KEGG   Drosophila hydei: 111597654Help
Entry
111597654         CDS       T05888                                 

Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
dhe  Drosophila hydei
Pathway
dhe04068  FoxO signaling pathway
dhe04144  Endocytosis
dhe04350  TGF-beta signaling pathway
dhe04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111597654
   04068 FoxO signaling pathway
    111597654
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111597654
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111597654
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dhe01001]
    111597654
Enzymes [BR:dhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111597654
Protein kinases [BR:dhe01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   111597654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal DUF2569
Motif
Other DBs
NCBI-GeneID: 111597654
NCBI-ProteinID: XP_023168241
Position
Unknown
AA seq 601 aa AA seqDB search
MWLKLLCLLALLNASYASPIEIVINTTNEAGGKAGHKLLPAAATTTTTTARTTTRNETAG
AYLTKSSLPFADNNGHGNNNNNSSFVPIQLHGTDAALASTAVAASPQLRQSAPTFPPLQN
KKHEKAIKCHCDICKDTNHICETDGYCFTSVEKDTDSKITFSFRCLDKRYELNREPLECL
SSRPKYDSYRIKCCNMDFCNKDELMKRIFETEYRSNKTLSSWQLVTIIVGATLSICFSGT
VVWYFCQRRKRLANGRPFAKEDSVYDPILNGNTTLHDIIEMTTSGSGSAGLPLLVQRSIA
RQVQLGHVIGKGRFGEVWRGRWRGENVAVKIFSSREECSWFREAEIYQTVMLRHENILGF
IAADNKDNGTWTQLWLVTDYHENGSLFDYLTTHTVDTNTMLNMALSIATGLAHLHMDIVG
TRGKPAIAHRDLKSKNILVKSNLSCAIGDLGLAVRHVEKDDSVDIPSTHRVGTKRYMAPE
VLDESMNAQHFDSYKRADVYAFGLILWEIARRCNMGMIFEEYQLPYWDAVQPDPSIEEMK
KVVCIEKSRPNIPNRWHASDVLHNMAKVMKECWYPNPVARLTALRIKKTLASIRVEDKVK
N
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtggctaaaactgctgtgcttattggcgctgctgaatgccagctatgcttcgcctatt
gagattgtcataaatacaacaaatgaagctggcggcaaagctggccacaaattgttacca
gcagcagcgacaacaacaacgacgactgcgagaacaacaacaagaaacgaaacagctggc
gcttatctaaccaaatcgtcgctgccttttgctgataacaacggccatggcaacaacaac
aataacagcagctttgtgcccatacagttgcacggaacagacgctgccttagcctccacc
gccgtcgctgcttcccctcagctgcgtcagtcagcgcccacattcccgccgttgcagaac
aagaaacacgagaaggcgatcaaatgccattgcgatatctgcaaggatacgaatcacatc
tgcgaaacggatggctattgttttacgtctgtggagaaggacaccgacagcaagataact
ttcagttttcgttgcctcgataagcgttacgagctgaatcgcgagccgttggaatgcctt
tccagtcgcccaaaatacgattcgtatagaattaagtgttgtaatatggatttctgcaat
aaagatgagcttatgaaaaggatatttgaaacagaatatcggtctaataagacgctgtcc
agttggcaattggtcactatcatagtgggcgccactttaagcatttgctttagtggcact
gttgtctggtatttctgccagcgtcgcaagcgtttggccaatggacgaccgttcgccaag
gaggattctgtctacgatcccatactaaatggcaacactacgctacatgatattattgag
atgaccacctcgggctctggatcggctggactgccgctgctggtgcagcgctcgattgca
cgtcaagtgcagctgggccatgtgattggcaagggacgtttcggcgaggtgtggcgcgga
cgctggcgtggcgaaaatgtggccgtcaagatcttctctagtcgtgaggaatgctcctgg
tttcgtgaggcggagatctatcaaactgtaatgttgcgtcacgagaatatattgggtttc
atagcagcggacaataaggacaacggcacctggacacagctgtggctagttacggattat
catgagaacggctcgctatttgattatttgaccacgcacaccgtggacactaataccatg
ttgaacatggcgctgagcattgccacgggtctggcacatctgcacatggacattgtgggc
acacgcggcaagcccgccattgctcatcgagatctcaagtcgaagaacatactggtcaaa
tcgaatttgagctgtgccattggagatctgggtctggcggtgcggcatgtggaaaaggat
gattctgttgatataccgtccacacatcgtgtgggcaccaagcgctatatggcgcccgag
gtgctcgacgagagcatgaatgcccagcacttcgattcgtataagcgtgcggatgtctat
gcctttggcctgatactgtgggagatagcgcgtcgctgcaatatgggcatgatctttgaa
gaatatcaattgccctactgggatgctgtgcagcccgatcccagcattgaggagatgaaa
aaggtcgtgtgcattgagaagagtcggccgaatatacccaatcgctggcatgcttcggat
gtgctccacaacatggccaaagtcatgaaggagtgctggtatcccaatccagtggcgcga
ctcacagcgctgcgcatcaaaaagacgctagccagcatacgtgtcgaggacaaggtcaag
aactga

DBGET integrated database retrieval system