KEGG   Drosophila hydei: 111597980Help
Entry
111597980         CDS       T05888                                 

Definition
(RefSeq) 12 kDa FK506-binding protein
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
dhe  Drosophila hydei
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dhe03110]
    111597980
Enzymes [BR:dhe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111597980
Chaperones and folding catalysts [BR:dhe03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    111597980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 111597980
NCBI-ProteinID: XP_023168723
Position
Unknown
AA seq 108 aa AA seqDB search
MGVQVVPISPGDGSTFPKNGQKVSVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGW
DEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtacaagttgttccaatttctcccggagatggtagcaccttcccaaagaatggc
caaaaagtttcagtgcattacactggcacattggacgatggcacaaagttcgattcgtct
cgggaccgtaacaagccctttaagttcaccattggcaagggtgaggttattcgcggttgg
gatgagggcgttgctcagctgagcgttggccaacgggccaagttgatttgctctcccgac
tacgcctacggcagccgtggtcatccaggtgtcattcctcccaactctaccttgactttc
gacgtcgaactgctcaaggtcgaataa

DBGET integrated database retrieval system