KEGG   Drosophila hydei: 111601572Help
Entry
111601572         CDS       T05888                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic isoform X1
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dhe  Drosophila hydei
Pathway
dhe00020  Citrate cycle (TCA cycle)
dhe00480  Glutathione metabolism
dhe01100  Metabolic pathways
dhe01200  Carbon metabolism
dhe01210  2-Oxocarboxylic acid metabolism
dhe01230  Biosynthesis of amino acids
dhe04146  Peroxisome
Module
dhe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dhe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111601572
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111601572
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111601572
Enzymes [BR:dhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     111601572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 111601572
NCBI-ProteinID: XP_023173990
Position
Unknown
AA seq 450 aa AA seqDB search
MFALRRTLNMAYAPQKLTQRCNFKVNFGVSAAMAQKVRSGPVVDVLGDEMTRIIWQSIKD
KLILPFVDIELHTYDLGIENRDKTNDQVTIDCAEAIKKYNVGIKCATITPDEKRVEEFNL
KKMWKSPNGTIRNILGGTVFREAIICKNVPRLVSGWQKPIVIGRHAHADQYKAVDYVVPG
PGQLTLTWKGTDGKVINEVINDFSGPGIALGMYNTDESIVDFAHASFKYALDRKMPLYMS
TKNTILKKYDGRFKDIFEDLYNKEYKKQYEAAGIWYEHRLIDDMVAYCMKSEGGFVWACK
NYDGDVQSDSVAQGYGSLGLMTSVLLCPDGKTVEAEAAHGTVTRHFRFYQQGKETSTNPI
ASIFAWTRGLLHRAKLDNNQQLKDFADTLEQVCIDTIEAGAMTKDLAICIKGNPNAVERK
DYQETFEFMDTLAKNLQIAINKGSKQQASL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcattacgccgcactctaaatatggcctacgcgccacaaaagttgacgcaaaga
tgcaattttaaagttaatttcggtgtctccgcggcgatggcgcagaaggtacgttctgga
cccgttgtcgatgtgctgggtgatgagatgactcgcatcatttggcagtcgattaaggat
aagctcattctgcccttcgtggacatcgagctgcacacatacgatctgggcatcgagaac
cgtgataagaccaacgatcaggtcaccatcgattgtgccgaggccatcaagaagtacaat
gtgggcatcaagtgcgccacaattacgcccgatgagaagcgcgtcgaggaattcaacctg
aagaagatgtggaaatcccccaacggcaccattcgtaacattctcggtggcacagtcttc
cgcgaggcaatcatttgcaagaatgtgcctcgtctcgtctccggctggcagaagccaatt
gtgatcggtcgccatgcccatgcggatcagtacaaggccgtcgactatgttgtgcctgga
cctggtcagttgacactcacgtggaagggcactgatggcaaggtcatcaatgaggttatt
aatgatttttcgggtcctggcattgccttgggcatgtacaacacggacgaatcgattgtg
gactttgcccatgcttcgttcaaatatgcgctggatcgcaagatgccgctgtacatgagc
accaagaacacaatcctcaagaagtacgatggtcgcttcaaggacatcttcgaggacctg
tacaacaaggaatacaagaagcaatacgaggccgccggcatctggtacgagcacagactt
atcgacgatatggttgcctattgcatgaagtctgagggcggcttcgtctgggcctgcaag
aactacgatggcgatgtccagtcggattccgttgctcagggttacggctcattgggcctg
atgacctcggtgctattgtgtcccgatggcaagactgtggaggctgaggctgctcacggt
acggtaacgcgtcacttccgtttctatcagcagggcaaggagacctccaccaatcccatt
gcttcgatctttgcatggacacgtggtctgctgcatcgcgccaagctggataacaatcag
caactgaaggacttcgccgatacactcgaacaggtctgcatcgacacaattgaggctggt
gcgatgaccaaggatctggctatttgcatcaagggcaacccaaatgctgtcgaacgcaag
gactaccaggaaaccttcgagttcatggacacgctggccaagaatctgcagatcgccatt
aataagggctccaagcagcaggcatctctttaa

DBGET integrated database retrieval system