KEGG   Drosophila hydei: 111603059Help
Entry
111603059         CDS       T05888                                 

Definition
(RefSeq) protein henna
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
dhe  Drosophila hydei
Pathway
dhe00360  Phenylalanine metabolism
dhe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dhe00790  Folate biosynthesis
dhe01100  Metabolic pathways
dhe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    111603059
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    111603059
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    111603059
Enzymes [BR:dhe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     111603059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT
Motif
Other DBs
NCBI-GeneID: 111603059
NCBI-ProteinID: XP_023176286
Position
Unknown
AA seq 452 aa AA seqDB search
MYQRQVSFDKPTRIEDSAYIAEGVDMQEARNTCLLFSPKDSSLASGALANTLAIFKKHDI
NLLHIESRSSLRVPGYEFFVECDGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWF
PRRIRDLDRFANQILSYGAELDADHPGFTDPEYRKRRKYFADIAYNYKHGEQLPHVDYTK
EEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFT
LRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELLGHVPLFADPAFAQ
FCQEIGLASLGAPDDYIEKLSTIFWFTVEYGMCRQEGELKAFGAGLLSSYGELEYCLTDK
PQLKDFEPEVTGITKYPITQFQPLYYVADSFENAKEKTIKFANSIPRPFGVRYNAYTQSV
EVLDSKPQISNLMNNINAEFQILQNAIVKLRV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaacgacaagtttccttcgataagcccacgcgcattgaggactcggcgtatata
gcggagggcgtggacatgcaggaggctaggaacacctgtctgctattctcgcccaaggac
tcgtcgcttgccagcggagccttggccaataccctggccatcttcaagaagcacgacatc
aatttgctgcacatcgaatcgcgctcgtcgctccgtgtgcccggctacgagttctttgtg
gagtgcgacggcaagtcgggtgcgctgggcaaagccattgaggatgtcaaggagcagtgc
agctacttcaacatcatctcgcgtgattacaaggacaatgccacggctgtgccttggttc
ccacggcgtatacgcgatctggatcgcttcgccaatcagatcttgagctacggcgccgag
ctggatgccgatcatcccggcttcacagatcccgagtaccgcaagcggcgcaaatacttc
gcggacatcgcctacaactacaagcacggcgagcagctgccccatgtggactatacgaag
gaggagatcgagacctggggcatcatctttcgcaatctgaccaagttgtacaagacgcac
gcctgccgcgaatacaatcacgtctttcccctgctcgtcgacaattgcggctttcgcgag
gataacataccccagctggaggatgtgtccaactttttgagggactgcacgggcttcact
ctgcgcccagtggctggcctgctcagctctcgcgatttcctcgccggcctggccttccgc
gtcttccactccacgcagtacattcggcatcccagcaagcccatgtatacacccgagccg
gacgtctgccacgagctgctgggtcatgtgccgctcttcgctgatccagcctttgcccag
ttctgtcaggaaattggcttggcttctctgggcgcacccgacgactacattgagaagcta
tccacgatcttctggttcacagtggagtatggcatgtgccgtcaggagggcgagctgaag
gctttcggtgctggtctgctctcttcctatggcgagcttgagtattgcctgacagacaag
ccacagctgaaagactttgagccggaagtgacgggcattaccaagtaccccattacacaa
ttccagccgctttactacgtggccgacagcttcgagaacgccaaagagaagaccattaaa
ttcgccaactcgattccgcgtcccttcggagtgcgctacaatgcctacacacagagcgtg
gaggtgctcgactccaagccccaaatctccaacctgatgaacaatatcaatgccgagttc
caaatactgcagaatgcgattgtcaagctgcgcgtttga

DBGET integrated database retrieval system