KEGG   Drosophila hydei: 111605464Help
Entry
111605464         CDS       T05888                                 

Definition
(RefSeq) tyrosine-protein phosphatase vhp-1
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
dhe  Drosophila hydei
Pathway
dhe04013  MAPK signaling pathway - fly
dhe04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    111605464
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111605464
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dhe01009]
    111605464
Enzymes [BR:dhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111605464
    3.1.3.48  protein-tyrosine-phosphatase
     111605464
Protein phosphatases and associated proteins [BR:dhe01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    111605464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 111605464
NCBI-ProteinID: XP_023179751
Position
Unknown
AA seq 452 aa AA seqDB search
MRIKREAPCLLLFMPIPNNNNNNNNRIGANHKDYPNNKRSRENLACDEQQLTTTSTAAMN
VGSNGGRTPPLMRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQ
SPSESHLQGLKYMQIPASDTPHQNIKQYFQEAFDFIEDARKTGSRVLLHCHAGISRSATI
AIAYVMRYKSLSLIEAYKLVKVARPIISPNLNFMGQLLELEQSLLKSGALAPLPTVTSAS
PAVSSQSPASSQLVEEPEEEEANQMPVSRKSKSDSEAMDEDVYDYDDVDSGASSFAGSNC
SSRLTSPPVTPDETPCTSAAAAAASSSSAAATELDSPCSNSSSGVYSISTSQEFAPAAAT
PAPVIPAATPATLSPTRPLALFKRNSPVKLRLNLEPSYNTPNIPKSISCISIHNASQHSP
LQREAPATPSCELAPTMPGDNNNNLVAATSSD
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcggataaagagagaagcgccgtgtctactgttatttatgccaatcccaaataataat
aacaacaacaacaatcgcattggtgctaatcacaaggactatcccaacaacaagcgatcc
agggaaaatctggcatgtgacgaacagcagctgacgacgacgtcaacggcagcaatgaac
gttggcagcaatggcggccgaacgccgccgctcatgcgcagctgctccagtccggcggtt
tacgatatcgaaacacatcccgcttcgccagtattcccacatctgctgctgggcaatggc
cgcgatgcggacgatcccagcagcgtgggcgccaattgtgtgttgaatgttacctgccaa
agtcccagcgagagtcatctgcagggcctgaagtatatgcaaatacctgccagcgatacg
ccccatcaaaatatcaagcaatattttcaggaggcattcgatttcatagaggatgcacgc
aaaacaggttcgcgcgtcttgttgcattgtcatgcgggcatctcgcgcagcgccaccatc
gccattgcctacgtcatgcgatacaagtcgctatcgctgatcgaggcctacaagctggtg
aaagtggcccggcccatcatctcgcccaatctgaacttcatgggccagctgctcgagctg
gagcagagcctgctgaagagcggcgccttggcgcctctgcccactgtaacatccgcatcg
cccgctgtcagcagccagtcgccagcatctagtcagctcgtggaagagcccgaggaggag
gaggcgaatcaaatgccagtttcacgcaaatctaaatcggatagcgaggccatggacgag
gacgtttatgattatgacgatgtggatagtggtgctagcagctttgccggcagcaactgc
tcatcgcgactaacctcaccgcccgtcacaccggatgagacgccctgcacatcggcagcg
gcggcggcggcatcatcgtcgtcggcggcagctactgaactggattcaccttgctccaat
agcagcagcggcgtctactccatttcaacgtcgcaagagttcgcacctgctgctgctacg
cccgcacctgttatacctgctgcaacgccggcgacgttgtcgcccacgcgaccgctggcg
ctcttcaagcgcaactcgccggttaagctgcgactcaatctcgagcccagctataacacg
ccaaacataccaaaatccatatcctgcatatccatacacaatgccagccagcacagtccg
ctgcagagggaggcgccagccacgcccagctgtgagctggcgcccacaatgccaggtgac
aacaacaacaatttggtggcggccacgtcgagtgattga

DBGET integrated database retrieval system