KEGG   Drosophila hydei: 111605535Help
Entry
111605535         CDS       T05888                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
dhe  Drosophila hydei
Pathway
dhe00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dhe00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    111605535
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    111605535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dhe01003]
    111605535
Enzymes [BR:dhe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     111605535
Glycosyltransferases [BR:dhe01003]
 Glycan extension
  P blood group
   111605535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 111605535
NCBI-ProteinID: XP_023179866
Position
Unknown
AA seq 334 aa AA seqDB search
MQDLFTIFHNTYDLELFQSEFASNRSVIEDILYSDSQPPPGHSIFFHETSCTYPNSHFHI
MNLTARQACAIESAALNNPNLQVFTLFSCPTYRPLFGRQKLLVDAIESYKNVNFRHLSVR
NYAKGTPIEEWVRKGDLLSSSYPMQHKSDLLRLISLYRFGGIYLDLDVVVLRSLEKLPLN
YVGAHDNTTLGNAVISLAPDGMGHEVAELFLQRYQKHFNGKSYVQNGPALVTEVLKKFCG
NSLIKAMQDGRESCKGFRIFNSTAFYSIPWPEWTHFTEPKYLEETMARTKDSFLIHIWNK
ASSVGRVEVGSNSAYEKYAEKHCPRTYAAAGDYI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatctgttcacaattttccataatacctacgatttagagttattccaatcagaa
ttcgcttcaaatcggagtgttatagaggatattttatactcggattcacaacctccgcca
ggacacagcattttttttcacgaaaccagctgcacttatccaaattcacatttccatatc
atgaatctgacggcacgtcaagcctgtgccatagaatctgctgctctgaacaatcccaat
ctgcaagtcttcactctgttttcctgtcccacttaccgtccacttttcggccgtcaaaaa
cttctcgtcgatgccattgagagctataagaatgtgaacttccgtcacttgagtgttagg
aactatgctaagggcactcccattgaggaatgggtcagaaaaggcgatttgctttcctct
agctatccgatgcaacacaaatctgacttgctccgtctcataagtctttatcggtttggg
ggcatctatctagacttggatgttgtcgtcctgcgaagtttggagaaattgcctttgaac
tatgtgggagcccatgataataccactctgggcaacgcagtcatcagtctagcacccgat
ggaatgggtcatgaggttgctgaactgtttttgcagcgctatcaaaaacactttaatggt
aaatcttatgtacaaaatggaccggcccttgtaactgaagtcctgaaaaaattttgtggc
aacagcctcatcaaggccatgcaggacggtcgcgagagctgcaaaggatttagaattttc
aattcgactgcgttttattcaattccttggccggagtggacacatttcactgagcctaaa
tatctggaggaaactatggcaagaactaaagattcgtttctcatacacatatggaacaag
gcatccagtgtaggccgcgtcgaagtcggctctaatagtgcgtatgaaaagtatgcggaa
aagcattgtcccaggacctatgcggcagctggtgattatatctaa

DBGET integrated database retrieval system