KEGG   Drosophila hydei: 111605730Help
Entry
111605730         CDS       T05888                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
dhe  Drosophila hydei
Pathway
dhe04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111605730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dhe01001]
    111605730
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dhe03036]
    111605730
Enzymes [BR:dhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     111605730
Protein kinases [BR:dhe01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   111605730
Chromosome and associated proteins [BR:dhe03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111605730
   Centrosome duplication proteins
    Regulators of centriole replication
     111605730
  Sister chromatid separation proteins
   Polo kinases
    111605730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 Pkinase_fungal POLO_box Kinase-like Haspin_kinase RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 111605730
NCBI-ProteinID: XP_023180190
Position
Unknown
AA seq 770 aa AA seqDB search
MLPYRNFGETIDEYEVQHLLGKGGFACVYKAKCLRTHQNVAIKMIDKKLIQGSGLSNRVR
QEVDIHSRLKHPSVLQLYTFFQDANYVYLILELADNGELHRYMNQQMKRPFTEDEASSIL
RQVVDGLLYLHSHNIMHRDISLSNLLLSKDMHVKIADFGLATQLKRPDERHMTMCGTPNY
ISPEVVSHMSHGLPADLWSVGCMLYTLLVGRPPFDTDAVQSTLNKVVRSDYTMPAHLSYE
ARDLIDKLLRKNPHERISLEQVLRHPFMSKAGGSTISYSTPSSLADCYGQSIASGDSGIV
TFASNDSKNSQRIRSGEQQSIPQILPQIQEEFGFYKENQFRVGSTDAMDSTDMDWKRMGQ
NTQKCNFLAPSTPSLAPVPETANPNNERISVPPLNTLRLQPTRYKTKNAIMSIVANGEVI
IEFIKCKSKMNEDRIVDICRISSDGRRIIIYQPDPGRGLPIREKPSELHSNGTDNAYSYD
NLPSKHWKKYVYAARFVGLVKSKTPKVTYFSKLAKCHLMENMADFEMTYYSGAKLTKSPS
EGIKVYDAHGALLSDQTSAETQRMIEHSNECFAHCLSICNALELAQTGSNTCFPVTIGRR
PITEVLPPQRSDSLRDTTNFAYSTPKSQQGSINFSMSTISSMRSDSDLIASQLLAAQQNV
PIKRLNIQGIGTATELSHGVVQVQFYDGSVISVIPETQGGGVTYTQPNGVSTHFPNHDDL
PLAIRDRLSQLPQVQMKLRCAPLMNSKKFECNAMNSKATTSAPWHNRMLI
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgctaccatatcgaaatttcggagaaacaatcgatgaatatgaagtacagcacctgctg
ggcaaaggaggcttcgcctgtgtttacaaggctaagtgtctgcgtactcatcaaaatgtg
gccattaaaatgattgacaagaagctcatacagggctcgggcttatcaaatcgagttaga
caagaagttgacatacattccaggctgaagcacccgtctgtgttgcagctttacacattt
tttcaggacgccaactatgtttacttaatattagaattggccgacaatggtgaactgcat
cgctatatgaaccagcaaatgaagcgtccatttacagaggacgaagcgtcttctatactg
cgccaggttgtagatggtttactttacttacactcgcacaacattatgcatcgggacata
tcgctttcaaatttgctgctcagcaaggatatgcacgtaaaaattgccgactttggcctg
gcgacccagttgaagaggcctgacgaaagacacatgaccatgtgcggtactcccaactat
atttcaccagaggtggtttcacacatgtcccatggtttgcctgctgatctctggagcgtt
ggctgcatgctttacacgctcttggtggggcgtccaccatttgacacagacgctgtacag
tcaacactcaataaggtggtacgctctgactatacaatgccagcacatttgtcctatgaa
gcacgcgatttgatcgacaagctgttaagaaagaatccgcatgagcgcatttccctggag
caagttctcaggcatccatttatgtcgaaggcaggtggaagcacaatctcctattcaaca
cctagctccctagctgattgctacggtcaaagcattgccagtggcgatagtggcattgtg
acatttgcgagcaatgattcaaagaactcgcaacggatacgctcgggagaacagcaatct
ataccacaaatactgccacagatccaggaagaatttggtttctataaggagaatcaattc
agggtgggatcaacagacgcgatggatagcaccgatatggactggaagcgtatggggcaa
aatacacaaaagtgcaattttttggcaccctcgacaccatcgcttgcacctgtaccagaa
actgccaatcccaataatgagcgtatatccgttccaccattaaacacgctccgtttgcaa
ccgacacgctataagaccaagaatgcaatcatgagcattgtggcaaatggcgaagtaatc
atcgaatttataaagtgcaaaagtaaaatgaatgaagatcgaattgttgatatatgtcgc
atttctagcgacggacggcgcataataatctatcagccagatccgggacgaggactgccc
ataagagagaagccttcagagctgcactcaaatggcactgataacgcttatagctatgat
aacttgcccagcaaacactggaagaagtatgtctacgcagcgcgatttgtgggcttggta
aagagcaaaactccgaaagttacgtacttcagcaaattggcgaaatgtcatttaatggaa
aacatggccgatttcgagatgacctactattccggtgccaagctgaccaaatctcccagt
gaaggaattaaagtgtatgatgcccacggcgcattgctctcggatcagacaagtgcagag
acacaacgtatgattgaacatagcaatgaatgcttcgcacactgcctgagcatttgcaat
gcactggagctggcgcaaactggtagcaatacttgttttccagtcacaattggaaggcgg
cccattacggaagtgttgcctccacaacgatcagacagtctgagagatacgaccaatttc
gcttactctacgcccaagtcacagcagggatccatcaacttctcaatgagcaccatctcc
tcgatgcgcagtgatagtgatttgattgcctcccagctgttagctgcccaacagaatgtg
ccgattaagcgattgaatatccaaggcataggcactgccacagagctgtcccatggagtt
gttcaagttcaattctatgacggatcagttatttcggtcataccggagactcagggtgga
ggtgtaacatatacgcaacccaatggggtttccacccactttcccaaccatgacgacctg
ccattggctattagggatcgactctcccagctgccccaggtgcagatgaagttgaggtgt
gctcctctgatgaatagcaaaaagtttgaatgtaatgccatgaactccaaggcgacgacg
tctgcaccttggcacaatcgtatgctaatatag

DBGET integrated database retrieval system