KEGG   Drosophila hydei: 115483777Help
Entry
115483777         CDS       T05888                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: Fanconi anemia group D2 protein-like
  KO
K10891  fanconi anemia group D2 protein
Organism
dhe  Drosophila hydei
Pathway
dhe03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    115483777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dhe03400]
    115483777
DNA repair and recombination proteins [BR:dhe03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     115483777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 CLASP_N
Motif
Other DBs
NCBI-GeneID: 115483777
NCBI-ProteinID: XP_030081879
Position
Unknown
AA seq 1479 aa AA seqDB search
MYRKFKKRNNALAGLNTIDENATIKIPRGSSAKQTDATIETLAVESEEENIPASQEQTQR
FLSQHSIALAATLGRTQSSSRMNSSRQPNSFFEMVLMNAGVQLDQTDTFVLSCDHIAIVS
KLRDILVQSTKYPENIETFKTGLNAALAPKSKLAQKLLSGCTIDTAGEDQVYQSQNSMFI
NFLMIDFLREPCLSVLFNKIEELAKQERVQTVPGCLPLLPMMLAQLRYLTLSHSDQIFSH
IERIFNNASESSKMDIISSAEFLLDASKHDEFVELLTINYSSSKDLFHLTTLQXLSNLTL
NARTQGKLRERILEFVKDDSSCSHVTLPHLIRLLLNSLNQDTDDVVRELVSTLREIFNWR
HRMQGENFQELAIPAAGDKQSQLELFGFLQQGLKRSKRFYQMWQRTISGLAASEFKSFDF
IMLLILIHINEDNTLFIENLFRRRIKLEHITVNILDEIKIHYSHILEQHINSLMHLLHDF
MREKNRIVADFAKAAYSILFKICNSIQKSILKKLLELTFDKSAQHVTTTLTLLRELQRKN
GKHIQNCAMLLLPLLDRLSDLTLPQTRLAMDLLCHVAFPEPKLPECAPLQDQIEMVVKKQ
QINRTEYVKRQGIIGCVQLIDAIARIETTLINNEDLQTSVDSITSLPDGRSKQAANLIML
TQSAICNSPELLALFYDELASVLTVRYYNAESIYMLDNQFLMWLCELMTYRFQQSFVNDH
QPKTVNGIRLECQKNINELDETNVNTESAVLDIGINISELVLSPNGIASDSIFVLAPLFH
LVSVLHNQRYQYSLELVNALQGCAIVLPTFFDDPNYLAIFDNYDEETQKRILHIYYHTIN
WMRVTTCAFASQKHEATRKRVLKRLADLICTEQRLKSLLTHAPVGFAPPPCQFLNIVKQG
APQQVTREKRPTTSKGKANKSMDQSKLGDFSIKLGNCKSIKCKINFEQLYGPMESFRQLD
VGIIVLLKEQPFSLNYPLEDEEVGTHLGVLELRFILTDLVHKLDTIINGCQDVTEAGTLR
SHVAKPEHFMSDLEKCLGEIHLRLIALAAHIDEELEKVNNVHSNLDLFKDRFNYVKTCFG
LCIHLLALYFSWNEWSDKSKIALLESSLNSLMPPGQRKAAKKPSIARIASQIFDYFCKYE
KSVLVLGTAVQLHHLLRSLRKLSCSGENAVQRSNQQAEDIRKYCTNMLRRKWYHYTGGLE
KGAQCNVHLDKLIKGFLKDTSFERQKDILFALKEECLLLNKKDLSLESIPNIKKPNFPLL
FRGLCEIIISTLNSQCSSPAXNDRFKLWESTICLLNGLLEIVQTVEQPRNFGLFLKHSQL
FLKLFLQHGVSVLETIVRDSPERLTKFFHELQNVTKFLHNLCCHSKSIKNTAIISYIPSL
RETLETLVFRIKALLAANKCHAAFHISILDNKDLHGDAIVTPRGSLINATNSDEEIPEDD
VSXDETYINDDEGSTLLDSSSRRSANSRSSKSNSRSKCF
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgaaaatttaagaaacgaaacaatgccctagcaggacttaatacaattgacgag
aatgcaactattaaaataccgcggggttcgtctgctaaacaaacagatgccacaatcgag
acattggccgtcgaaagtgaagaggaaaatataccagcttcgcaggagcaaacacaacgt
tttctatcgcaacatagcatagcattggccgctacattggggcgcacgcagtcttcatcg
cgaatgaacagttcccgccaaccgaatagcttctttgaaatggtgctgatgaacgctggt
gtgcaattggaccaaacggacacattcgtgctgtcttgcgatcatattgctattgtttct
aagctacgtgatatattggtgcagtctacgaagtatccggaaaacattgagacatttaaa
actgggctaaatgcggctctagcgcccaaatcaaaactggcccagaaactgctaagtggc
tgcaccatagacacagccggcgaagatcaggtttatcagtcacagaacagcatgtttatc
aactttctgatgattgactttctacgggagccctgcctgtcagtacttttcaacaaaatc
gaagagctggccaagcaggagcgagtgcaaacggtgcctggttgcctgccactattacca
atgatgcttgcccaattacgttatcttactctgtcgcatagtgatcagattttttcccat
attgagcgcatattcaacaatgcttcagagtcgtcaaagatggatatcataagcagcgct
gagtttttattagacgccagtaaacacgacgagtttgtcgagttgctcactattaactat
tcgagcagcaaagatcttttccatttgacaacgctgcaantgttaagcaatttgacgcta
aatgccaggactcaaggaaaattgcgggagcgtattctagagtttgtcaaggacgatagc
agctgctcgcatgtgacactgccgcatctcatacgcctattgctaaatagtctcaatcag
gacaccgacgatgttgttcgtgagctggtctccacactgcgtgaaatctttaactggcgt
catagaatgcaaggcgaaaactttcaggagttggccattcctgctgccggtgacaagcaa
tcacaattggaactctttggttttctgcaacaaggtcttaagcggtctaagcgtttttat
caaatgtggcagcgtactattagtggattggcagccagtgaatttaaatcatttgatttt
ataatgctactgatacttatacacatcaacgaggataatactttatttattgagaatctt
tttcgccgacgtattaaactagagcatataacagttaacatattagatgaaataaaaatc
cattattcgcatattttggagcaacatattaactcactgatgcacctgctccacgacttt
atgcgggaaaagaatcgcattgtagccgacttcgccaaagcggcctacagcatactcttt
aagatctgcaactcaatacagaaaagcatactgaagaaactgctggagctgacatttgac
aagtctgcacagcatgtgaccaccacattgacattgctgcgtgagctgcagcgcaagaat
ggaaagcatatacagaactgtgccatgttgttactgccattgctcgatcgcctaagcgat
ttgaccctgccacaaacacgtctcgccatggacttgctatgccacgttgcatttcctgaa
cccaaattgcctgagtgtgccccactgcaggatcaaatcgaaatggttgtaaagaaacag
caaataaatcggactgaatatgtgaaaaggcagggcataattggttgcgtacagctaatt
gatgccattgcgcgcattgaaaccacgcttatcaataacgaggacttgcaaaccagcgtg
gacagcatcacttcattgcctgatggtcgcagcaagcaggcagctaacctgattatgctc
acccagtcagctatatgtaattcacccgaattactggcactgttttacgatgaactggcc
agcgtactaactgtgcgctactataacgcagagtctatttatatgctcgacaatcagttt
cttatgtggctctgtgagctaatgacctatcgctttcagcaaagctttgtgaatgatcat
cagcccaagacagtcaacggcatacggctggagtgccagaagaacattaatgaattggac
gaaacgaatgttaataccgaatcagctgtactagatatagggattaatatatctgaattg
gttttgagtccaaatggaatcgccagcgattctatttttgtgctagcgccgctctttcac
ttggtcagcgtgctgcacaatcaacgctatcagtacagtctggaattggtaaatgcactc
caaggctgtgccattgtgctgcccacgttttttgatgatcctaattatttggccatcttt
gataattatgatgaagagacacaaaagcgcatattgcacatttactatcacacgatcaat
tggatgcgtgttacgacctgcgcttttgcctcccaaaagcatgaagccacacgcaaacgg
gttctaaagcgtctcgccgatttgatttgcacagagcaaagattgaagtcacttttgact
catgctcctgttggttttgcgccaccgccctgccagtttcttaacattgttaaacagggc
gctccccagcaagttacgcgcgaaaaaagacctacgactagtaagggcaaggcaaataag
agcatggaccaatcaaaattgggtgatttcagcatcaagttgggtaattgcaaatccatt
aaatgcaaaatcaattttgaacagctatatggacccatggaaagctttagacagcttgat
gtgggtataatagtgttgctgaaagaacaacccttcagcttgaattacccactggaagac
gaagaagtgggtacacatttgggcgtgttggaattgcgttttatactaacagatttggta
cataaattggatactattattaacggatgccaagacgttaccgaagctggcacgttaaga
tcgcatgtggccaagccagagcattttatgtctgatttagaaaaatgtttaggtgaaatc
catctgcgtttaatagcgctcgcggcacacattgatgaggagctagaaaaggtcaataat
gtccacagcaatttggatctgttcaaggatcgatttaattatgttaaaacctgctttggc
ttatgcattcacttgcttgcattgtatttctcatggaatgagtggagtgacaagtccaaa
atcgcgttgctagagtcttcattaaattcactgatgccccctggccagcgcaaggcagcg
aaaaaaccatccatagcacgcattgcctcccagatctttgattatttctgcaaatacgaa
aaatcggtgctagtacttggcactgccgtgcagcttcaccatttgctgcgcagcttgcgt
aaattgagttgttccggcgagaatgcagttcagcgcagcaatcagcaggccgaggatata
cgaaaatattgtaccaatatgctgagacgcaaatggtaccactacactggtggcttggaa
aagggagcacaatgtaacgttcatctcgacaagcttattaaaggctttcttaaggacaca
tcatttgaacgtcagaaggatattttatttgcccttaaagaggagtgcctgcttctaaat
aaaaaagacttgtctttagaatcgattcccaatattaaaaagcctaactttcccctattg
tttcgtgggctatgcgagattattatcagcacattgaattcccaatgtagtagtcccgct
ngaaacgatcgcttcaagctctgggaatcaactatatgtctccttaatggccttttggaa
attgtccagactgtggaacagccgcgcaattttggcttattcttaaagcattcgcaattg
ttcctgaaactgttcctacaacatggtgtgtccgttcttgagacgattgtgcgcgatagt
cccgaacggttaaccaaattttttcacgagctacagaatgtaaccaagtttttgcacaat
ctctgttgccattcgaagtcaataaagaatactgccattattagctacattcctagccta
cgtgaaacgctggaaacactggtgtttcgtataaaagcgttgctggcggccaacaaatgt
catgccgcctttcatatcagtattttggataataaggatttgcatggcgatgcaattgtg
actcccaggggatcacttatcaacgcaactaatagcgatgaagaaatccccgaagatgac
gtcagcngtgatgaaacttatataaatgatgatgagggcagcactcttctggatagttct
tcgcgacgcagcgcaaatagtcgcagcagcaaatcaaattcacgcagtaaatgtttttaa

DBGET integrated database retrieval system