KEGG   Delftia sp. HK171: BO996_02025Help
Entry
BO996_02025       CDS       T04584                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00071  Fatty acid degradation
dhk00072  Synthesis and degradation of ketone bodies
dhk00280  Valine, leucine and isoleucine degradation
dhk00310  Lysine degradation
dhk00362  Benzoate degradation
dhk00380  Tryptophan metabolism
dhk00620  Pyruvate metabolism
dhk00630  Glyoxylate and dicarboxylate metabolism
dhk00640  Propanoate metabolism
dhk00650  Butanoate metabolism
dhk00900  Terpenoid backbone biosynthesis
dhk01100  Metabolic pathways
dhk01110  Biosynthesis of secondary metabolites
dhk01120  Microbial metabolism in diverse environments
dhk01130  Biosynthesis of antibiotics
dhk01200  Carbon metabolism
dhk01212  Fatty acid metabolism
dhk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BO996_02025
   00630 Glyoxylate and dicarboxylate metabolism
    BO996_02025
   00640 Propanoate metabolism
    BO996_02025
   00650 Butanoate metabolism
    BO996_02025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BO996_02025
   00072 Synthesis and degradation of ketone bodies
    BO996_02025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BO996_02025
   00310 Lysine degradation
    BO996_02025
   00380 Tryptophan metabolism
    BO996_02025
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BO996_02025
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BO996_02025
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BO996_02025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dhk04147]
    BO996_02025
Enzymes [BR:dhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BO996_02025
Exosome [BR:dhk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BO996_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SnoaL_4 ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: APE46714
Position
442088..443296
Genome map
AA seq 402 aa AA seqDB search
MRRAAIVTPLRTPVGTFGGSLRPVSVEELAATTVRAVVEKSGIDPARIDDVVFAQSYASS
ETPCVGRWAALQAGLPVTVPGMQLDRRCGGGLQAVATAAMMVQSGAADVVIAGGVESMSN
IEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVERFGKISGMIETAENLARDYGISREAA
DAYAVRSHQRAAAAWEAGRFADEIVPVKVPQRKGDPVLFTRDEGFRADATTDSMGKLRVL
MPNGTVTAGNASQQNDASAACLIVAEDRLAELGLTPMATLVGWAAAGCEPSHMGIGPVPA
VKKLLARLNLTLDQMDLVELNEAFACQVLSVLKGWEWNDQDAIDHKLNVNGSGISLGHPI
GATGVRILATLLHELERRKGRYGLETMCIGGGQGIAAVFERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagagccgccatcgtcaccccccttcgcacgcccgtgggcaccttcggcggcagc
ctgcggccggtatcggtcgaggagctggccgccaccacggtgcgcgccgtggtcgagaaa
agcggcatcgaccccgcacgcatcgacgacgtggtcttcgcccagtcctacgccagcagc
gagacgccctgcgtgggccgctgggccgcgctgcaggccggcctgccggtgacggtgccg
ggcatgcagctggaccggcgctgcggcggcggcctgcaggccgtggccacggcggccatg
atggtgcaaagcggcgccgccgacgtggtgatcgcaggcggcgtggaaagcatgagcaac
atcgagtactacagcaccgacatgcgctggggtgcgcgctcgggcaatgtgcgcttctac
gaccggctggaccgcggccgcgagcgctcccagcccgtggagcgcttcggaaagatctcg
ggaatgatcgagaccgccgagaacctggcgcgcgactacggcatcagccgcgaggcagcc
gacgcctatgccgtgcgcagccaccagcgcgccgccgctgcctgggaggcgggccgcttc
gccgacgagatcgtccccgtcaaggtgccccagcgcaagggcgaccccgtgctgttcacg
cgcgacgaaggctttcgcgccgacgccaccaccgacagcatgggcaagctgcgcgtgctc
atgcccaatggaacggtcacggccggcaatgccagccagcagaatgacgccagcgccgcc
tgcctgatcgtggccgaggaccggctggccgaactgggcctcacccccatggccaccctg
gtgggctgggccgccgcaggctgcgagccctcgcacatgggcataggccccgtgcccgcc
gtcaagaagctgctggcgcgcctgaacctcacgcttgaccagatggacctggtcgaactc
aacgaagcctttgcctgccaggtgctgtccgtgctcaagggctgggagtggaacgaccag
gacgccatagaccacaagctcaacgtcaacggctccggcatctccctgggccaccccatc
ggcgccaccggcgtgcgcatcctggccaccctgctgcacgagctggagcgccgcaagggc
cgctatgggctggagaccatgtgcataggcggcggccaggggattgcggcggtgttcgag
cgggtgtga

DBGET integrated database retrieval system