KEGG   Delftia sp. HK171: BO996_03385Help
Entry
BO996_03385       CDS       T04584                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00620  Pyruvate metabolism
dhk00630  Glyoxylate and dicarboxylate metabolism
dhk01100  Metabolic pathways
dhk01110  Biosynthesis of secondary metabolites
dhk01120  Microbial metabolism in diverse environments
dhk01200  Carbon metabolism
Module
dhk_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BO996_03385
   00630 Glyoxylate and dicarboxylate metabolism
    BO996_03385
Enzymes [BR:dhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BO996_03385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: APE46955
Position
complement(750138..752330)
Genome map
AA seq 730 aa AA seqDB search
MTDRTQAHSLQVATELHRFINEQVLPGTGVAPEAFWKGFDAIVNDLAPRNAALLAERDRL
QTELDTWHKAHPGPITDMAGYQQFLTQIGYLVEQPKDAKATTTNVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAIGEDGGAEKGKGYNPVRGAKVIAFARDFLDQAA
PLASGSHKDAAGYRVEAGQLVVALKSGGTTGLKNTAQFVGYQGDAAAPSSVLLLNNGLHI
DIRIDKTTAIGQTDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVVGYANWLGILKGTL
TETFDKGGKSMTRGLNADREYTGADGKSVKLHGRSLMFVRNVGHLMTNPAILWGNGKEIP
EGILDAMVTTAIAVHDIKGLGANGIRNSRTGSVYIVKPKMHGPAEAAFASELFGRVEKVL
GLPENTVKLGIMDEERRTSVNLKACIAAAASRVAFINTGFLDRTGDEMHTAMYAGPMVRK
ADMKGSAWLAAYERSNVLVGLGLGLRGKAQIGKGMWAMPDLMKAMLEQKIGHPKAGANTA
WVPSPTAATLHALHYHQVNVAEVQKQLEQTNADAERATILADLLQVPVVKEDKWSAAEKQ
QELDNNVQGILGYVVRWVDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLQHGIVTE
AQVRETFERMAAVVDQQNAGDALYKPMAGHFDTSMAYQAACDLVFKGKEQPSGYTEPLLH
AWRLKVKAAA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcacccaagcccacagcctgcaggtcgctacagagctgcaccgtttcatc
aatgaacaagtgctcccgggcaccggtgtcgctcccgaggcgttctggaaaggcttcgac
gcgatcgtcaacgatctggctcctcgcaatgccgccctgctggccgagcgcgaccgcctg
cagaccgagctggacacctggcacaaggcccatcccggccccatcaccgacatggccggc
taccagcagttcctgacgcagatcggctatctggtcgagcagcccaaggatgccaaggcc
accaccaccaatgtggatgcggaactggccatccaggccggtccccagttggtcgtgccc
attctcaacgcccgctatgcgctgaacgccgccaacgcgcgctggggttcgctgtatgac
gcgctgtacggcacggacgccatcggcgaagacggcggcgcggaaaagggcaagggctac
aaccccgtgcgcggcgccaaggtgatcgccttcgcacgtgatttcctggaccaggcagcc
ccgctggcctcgggctcgcacaaggatgccgccggctatcgcgtggaagctggccagctg
gtcgtcgcgctcaagagcggcggcaccacgggcctgaagaacaccgcccagttcgtcggc
taccagggtgatgccgcagcgccctcttccgtgctgctgctcaacaacggcctgcacatc
gacatccgcatcgacaagaccacggccatcggccagaccgatgccgccggcgtggccgac
gtggtggtcgaagccgccctgtccaccatcctggacctggaagactccgtggccgccgtg
gatgccgaggacaaggttgtcggctatgccaactggctgggcatcctcaagggcacgctg
accgaaaccttcgacaagggcggcaagagcatgacgcgcggcctgaacgccgaccgcgag
tacacgggcgccgatggcaagtccgtcaagctgcatggccgttcgctgatgttcgtgcgc
aatgtcggccacctgatgaccaatccggccatcctctggggcaacggcaaggaaatcccc
gagggcatcctggacgccatggtcaccacggccatcgccgtccacgacatcaagggtctg
ggcgccaacggcatccgcaactcgcgcacgggcagcgtctacatcgtcaagcccaagatg
cacggccccgcggaagccgccttcgccagcgagctgtttggtcgcgtggaaaaggtcctg
ggcctgcccgagaacaccgtcaagctgggcatcatggacgaggagcgccgcaccagcgtc
aacctcaaggcctgcatcgccgccgccgcatcgcgcgtggccttcatcaacaccggcttc
ctggaccgcacgggcgacgaaatgcacaccgccatgtatgccggccccatggtccgcaag
gccgacatgaagggcagcgcctggctggccgcctatgagcgcagcaacgtgctcgtgggc
ctgggcctgggcctgcgcggcaaggcgcagatcggcaagggcatgtgggccatgcccgac
ctgatgaaggccatgctggagcaaaagatcggccaccccaaggccggcgccaataccgcc
tgggtgccctcgcccacggccgccacactgcacgccctgcactaccaccaggtcaacgtg
gccgaagtgcaaaagcagctggagcagaccaatgccgacgccgagcgcgccaccatcctg
gccgacctgctgcaggtgcccgtggtcaaggaagacaagtggagcgccgccgagaagcag
caggagctggacaacaacgtccagggcatcctcggctacgtggtgcgctgggtggaccag
ggcgtgggctgctccaaggtgcccgacatccacaacgtgggcctgatggaagaccgcgcc
acgctgcgcatctccagccagcacatcgccaactggctgcagcacggcatcgtgaccgag
gcccaggtgcgcgagaccttcgagcgcatggccgccgtggtcgaccagcagaacgcgggc
gatgcgctgtacaagcccatggccggccacttcgacacctcgatggcctaccaggccgcc
tgtgacctggtcttcaagggcaaggagcaacccagtggctacaccgagcccctgctgcat
gcctggcgcctgaaggtcaaggcagccgcctga

DBGET integrated database retrieval system