KEGG   Delftia sp. HK171: BO996_03815Help
Entry
BO996_03815       CDS       T04584                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00430  Taurine and hypotaurine metabolism
dhk00620  Pyruvate metabolism
dhk00640  Propanoate metabolism
dhk00680  Methane metabolism
dhk01100  Metabolic pathways
dhk01120  Microbial metabolism in diverse environments
dhk01200  Carbon metabolism
Module
dhk_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BO996_03815
   00640 Propanoate metabolism
    BO996_03815
  09102 Energy metabolism
   00680 Methane metabolism
    BO996_03815
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BO996_03815
Enzymes [BR:dhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BO996_03815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: APE47033
Position
complement(843916..845148)
Genome map
AA seq 410 aa AA seqDB search
MIPAHTASSPARELVVVLNCGSSSIKFAVFDGAQRPLPRKPLWNGKVQGIGGPAPDFGES
GVSPFAIALDAAHPYRAALQLIRERITARLAQLDGARVAAVAHRVVHGGSRYFEPVRVDA
GVLADLKAFIPLAPLHQPFALEAMDILLRERPELVQVACFDTAFHHTLPKVEQLLPLPHA
AWERGLRRYGFHGLSYEYMATALPERHGDLARGRTLVAHLGSGASLCAMQGLQSVATTMG
FSALDGLMMGTRTGALDPGAVIYLMEIEKLSLQEVGRILYHESGLLGVSGTSSEPRVLLP
LESGADAQAERARDALALYVRRIVREIGALVAVLGGLDLLVFTAGVGEHSAEIRRRVCEG
LGFLGLRLDAEANARDATVISATGSAVTVGVEPTNEEWVAARHALRWLPG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatccctgcccacaccgcatcctcccccgcccgcgaactggtcgtggtgctcaactgc
ggctcgtccagcatcaagttcgccgtcttcgacggtgcccagcgcccgctgccgcgcaag
ccgctgtggaacggcaaggtccagggcatcggcgggcccgcgcccgacttcggcgagagc
ggcgtttcgccctttgccattgccctggatgccgcccacccctaccgcgccgcgctgcag
ctgatccgcgagcgcattaccgcgcgcctggcgcagctggacggcgcccgcgtggctgcc
gtcgcccaccgcgtggtgcacggcggcagccgctacttcgagcccgtgcgcgtcgatgcc
ggcgtgctggccgacctcaaggccttcatcccgctggcgccgctgcaccagccctttgcg
ctggaggccatggacatcctgctgcgcgagcggcccgaactggtgcaggtggcctgcttc
gacaccgccttccaccacacgctgcccaaggtcgagcaactgctgcccctgccgcatgcg
gcctgggaacgcgggctgcgccgctacggcttccacggcctgtcctacgaatacatggcc
accgccctgcccgagcgccatggcgacctggcgcgcgggcgcaccctggtggcccacctg
ggcagcggcgccagcctgtgcgccatgcagggcctgcaaagcgtggcgacgaccatgggg
ttctctgcgctggacggcctgatgatgggcacgcgcaccggcgcgctggaccccggcgcc
gtgatctacctgatggaaatcgaaaagctcagcctgcaggaagtgggccgcatcctgtac
cacgagtccggcctgctgggcgtctcgggcacctcgtccgagccgcgcgtgctgctgccg
ctggagtcaggcgccgatgcccaggccgagcgcgcgcgcgatgcgctggccctgtacgtg
cggcgcatcgtgcgcgagatcggcgccctggtcgccgtgctgggcggcctggacctgctg
gtgttcaccgcaggcgtgggcgagcacagcgccgagatacggcggcgcgtgtgcgagggc
ctgggttttctgggcctgcggctggacgccgaggccaatgcgcgcgatgcgaccgtgatc
tcggccaccggcagcgccgtcaccgtgggcgtggagcccacgaacgaggaatgggtggca
gcgcgccatgcgctgcgctggctgccgggctag

DBGET integrated database retrieval system