KEGG   Delftia sp. HK171: BO996_08725Help
Entry
BO996_08725       CDS       T04584                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00450  Selenocompound metabolism
dhk00970  Aminoacyl-tRNA biosynthesis
dhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BO996_08725
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BO996_08725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dhk01007]
    BO996_08725
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dhk03016]
    BO996_08725
Enzymes [BR:dhk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BO996_08725
Amino acid related enzymes [BR:dhk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BO996_08725
Transfer RNA biogenesis [BR:dhk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BO996_08725
 Prokaryotic type
   Other AARSs
    BO996_08725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1f DALR_1
Motif
Other DBs
NCBI-ProteinID: APE47933
Position
complement(1935873..1937939)
Genome map
AA seq 688 aa AA seqDB search
MTARKLFVTTALPYANGNFHIGHIMEYIQADTWVRAQRMQGNAVNFVGADDAHGAPIMIA
AEKAGKTPQQFVADIAAGRKQYLDGFHIAFDNWHNTDAPENHVLAQQIYRDLKAAGFIET
RTIEQFFDTEKNMFLPDRFIKGECPRCHAKDQYGDNCEVCSAVYAPTDLINPYSALSGAK
PVLKSSEHFFFKLSDPRCVEFLTEWTQDGQHVQPEVANKIKEWFGVRTNPDGTTSEGLGD
WDISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKNLLDRRGEDYEAYMADPTLEQYH
FIGKDIITFHTLFWPAMLKFSGRKTPTKICVHGFMTVNNGEKMSKSRGTGLDPLKYLGLQ
MNPEWLRYYLGAKLNGKNEDIDFNPDDFMARVNSDLIGKYVNIASRAAGFIAKRFDGKLG
TVSEDGQALLAQLRGQSEAVVQAFENRDTARAVREIMQLCDRVNEYVDANKPWELAKQEG
MDARLQDVCTTCIEAFRLLTIYLKPILPAVAEQVEGFLNVAPLQFADAQNLLGAGHAIGL
YKHLMQRVDVKQLEALFEAPEPVVEKVLPGGEEIAETISIDDFAKVDLRIAKIVECKPVE
GSTKLLQLTLDVGEGKTRNVFSGISSMYQPEQLQGKLTVMVANLAPRKMKFGISEGMVLA
ASHADEKANPGIYVLEPFPGATPGMRIH
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcaaactcttcgtcaccaccgccctgccgtacgccaacggcaacttccac
atcggccacatcatggaatacatccaggccgacacctgggtgcgtgcgcagcgaatgcag
ggcaacgcggtcaacttcgtgggtgccgatgacgcccacggcgcgcccatcatgattgcg
gccgagaaggccggcaagacgccccagcagttcgtggccgacatcgccgcaggccgcaag
cagtacctggacggcttccacatcgccttcgacaactggcacaacaccgacgcgcccgag
aaccacgtgctggcccagcagatctacagggacctgaaggctgccggcttcatcgagacg
cgcaccatcgagcagttcttcgacaccgagaagaacatgttcctgcccgaccgcttcatc
aagggcgaatgcccgcgctgccatgccaaggaccagtacggcgacaactgcgaggtctgc
agcgccgtctacgcgcccaccgacctgatcaacccctactcggcgctgtccggcgccaag
cccgtgctcaagagctcggagcatttcttcttcaagctgtcggacccgcgctgcgtggag
ttcctgaccgagtggacccaggacggccagcatgtgcagcccgaggtggccaacaagatc
aaggaatggttcggcgtgcgcaccaacccggacggcacgaccagcgagggcctgggcgac
tgggacatctcgcgcgacgcgccctacttcggcatcgagatccccgatgcgccgggcaag
tacttctacgtctggctggacgcgcccgtgggctacctggcctcgctcaagaacctgctg
gaccgccgtggcgaggactacgaggcctacatggccgaccccacgctggagcagtaccac
ttcatcggcaaggacatcatcaccttccacacgctgttctggcccgccatgctgaagttc
agcggccgcaagacgcccaccaagatctgcgtgcacggcttcatgaccgtgaacaacggc
gagaagatgagcaagagccgcggcaccggcctggacccgctcaagtacctgggcctgcag
atgaaccccgagtggctgcgctactacctgggcgccaagctcaacggcaagaatgaagac
atcgacttcaaccccgatgacttcatggcccgcgtcaattccgacctgatcggcaagtac
gtgaacatcgcctcgcgcgctgccggcttcatcgccaagcgcttcgacggcaagctgggc
acggtcagcgaagacggccaggccctgctggcccagctgcgcggccagagcgaggccgtt
gtccaggccttcgagaaccgcgacacggcccgcgccgtgcgcgaaatcatgcagctgtgc
gaccgcgtcaacgaatacgtggatgccaacaagccctgggagctggccaagcaggaaggc
atggacgcccgcctgcaggacgtgtgcaccacctgcatcgaggccttccgcctgctgacc
atctacctgaagcccatcctgccggccgtggccgaacaggtggaaggcttcctgaacgtg
gcgccgctgcagttcgccgacgcacagaacctgctgggcgccggccatgccatcggcctg
tacaagcacctgatgcagcgcgtggacgtcaagcagctggaggccctgttcgaggccccc
gagcccgtggtcgagaaggtcctgcccggcggcgaggagattgccgaaaccatcagcatc
gacgacttcgccaaggtggacctgcgcatcgccaagatcgtggaatgcaagcccgtggaa
ggctcgaccaagctgctgcagctcacgctggacgtgggcgaaggcaagacacgcaacgtg
ttctccggcatctccagcatgtaccagcccgagcagctgcagggcaagctcaccgtgatg
gtggccaacctggcgccgcgcaagatgaagttcggcatctccgaaggcatggtgctggca
gccagccacgccgatgagaaggccaaccccggcatctacgtgctggagcccttccccggt
gccacacctggcatgcgtatacattga

DBGET integrated database retrieval system