KEGG   Desulfovibrio hydrothermalis: DESAM_20479Help
Entry
DESAM_20479       CDS       T02428                                 

Definition
(GenBank) Uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00860  Porphyrin and chlorophyll metabolism
dhy01100  Metabolic pathways
dhy01110  Biosynthesis of secondary metabolites
dhy01120  Microbial metabolism in diverse environments
Module
dhy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DESAM_20479
Enzymes [BR:dhy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     DESAM_20479
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DESAM_20479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: CCO22766
UniProt: L0RB03
Position
complement(788857..790371)
Genome map
AA seq 504 aa AA seqDB search
MGLVYLIGAGPGDPGLLTVKAKEVLETADVLIYDYLANIEFLSYCKADCEILYVGKKGGD
HTLPQDKINELIVEKAKEGKVIARLKGGDPYVFGRGGEEAEELVEAGIAFEVIPGITAGV
AAPAYAGIPVTHRDFTTSVCFITGHEDPTKEKTGHDWEVYAKSTSTLVFYMGVKNLPMIA
ENLIKNGRDPETPVALVRWGTRCNQQSFVSTLENVAAEAAERKFKAPSIIVVGGVCSLHD
KLGWFEKKPLLNKGVVVTRAREQASGLVATLGKLGACVFEFPTISIEPVADYAPVQKEIK
ALANWDWLIFTSVNGVKHFFAQLDESGLDARAFAGLEIAAIGPATAEALVAKGIKPDFVP
EKYIAEGVVAGLLEKGVKGKKVLIPRAKVAREVLPEELRKAGAEVKILPVYETGLSENDP
GPVAEALESGKINYLTFTSSSTVENFFNLIEPEHFHKYKDSVKIVCIGPITTKTLEGFGF
EPDIQPEDYTIPALVEVLVQEAAE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcttagtatatctcatcggcgcaggtcccggcgaccccggtctgctgactgttaag
gctaaggaagttttggaaacagcagatgtcctgatttatgactatctggctaatatcgaa
tttctttcctactgcaaagctgattgcgaaatcctttacgtaggcaaaaagggtggcgac
cacactctgccgcaggataaaatcaacgaacttatcgttgaaaaagctaaagagggcaag
gtcattgcccgtctgaaaggtggcgatccttacgtattcggccgcggcggcgaagaggcg
gaagagctggttgaagccggaattgcttttgaagtcattcccggtattactgccggtgtt
gccgctcccgcatatgccggtattccggtaacccacagagatttcactacttccgtatgt
tttatcaccggtcatgaagacccgaccaaggaaaagaccggacatgactgggaagtttac
gctaagtctaccagtacactggtcttctacatgggtgttaaaaatctgcctatgatcgcc
gaaaatctgatcaagaatggacgcgaccccgaaacacctgttgccctcgtgcgttgggga
acccgctgtaatcagcagtctttcgtttccactcttgaaaacgttgcagctgaagccgca
gagcgtaagttcaaggcaccttccatcattgttgtcggcggtgtctgttctttgcatgac
aagctgggctggtttgaaaagaaacctctgctcaacaaaggcgtggtggtcacccgtgca
cgtgaacaggccagcggccttgttgccaccctcggcaaactcggtgcctgtgtgttcgaa
ttcccgaccataagcattgaacccgttgccgattacgcccctgtgcagaaagagatcaaa
gcccttgcaaactgggactggctgatctttacttctgtcaacggggtgaaacatttcttc
gcacagcttgatgaatccggacttgatgcccgtgcatttgccggactcgaaattgccgct
atcggacctgctacagctgaggccctcgttgccaaaggtatcaagcctgactttgtacct
gaaaagtatattgcagaaggcgtggttgccggactgctcgaaaagggtgttaaaggcaaa
aaagtactcatccccagagcaaaagttgcccgtgaagttctgcctgaggaactccgtaag
gccggtgctgaagttaaaattctgcctgtctacgaaaccggactttccgaaaatgatccc
ggtcccgttgccgaggcccttgagtccggtaaaattaattacctgaccttcaccagctcc
agcaccgttgagaattttttcaacctcattgagccggagcattttcacaagtataaagat
tcagtcaaaattgtctgtataggtccgatcacgaccaagacccttgagggtttcggtttt
gagcctgacattcagcctgaagattacaccatacccgcactggtagaagtactggtgcag
gaagcagcagaataa

DBGET integrated database retrieval system