KEGG   Desulfovibrio hydrothermalis: DESAM_20710Help
Entry
DESAM_20710       CDS       T02428                                 

Gene name
pyrB
Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00240  Pyrimidine metabolism
dhy00250  Alanine, aspartate and glutamate metabolism
dhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DESAM_20710 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DESAM_20710 (pyrB)
Enzymes [BR:dhy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     DESAM_20710 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CCO22997
UniProt: L0R9V8
Position
1022844..1023770
Genome map
AA seq 308 aa AA seqDB search
MEWQHKDLLDITQLNKEEVQHVFETATYFQEINSRPVKKVPTLKGHSVVLFFAEPSTRTK
VSFDMAGKRLSCDTFSLAKSSSSLTKGETLKDTALTLQAMNPDGIVLRHWASGSAAFLAE
RLDCSIINAGDGRHAHPTQALLDGFTLYQEWGSLEGKTVLILGDIAHSRVARSNVILLTM
MGAKVRLCGPRTLLPPYLKNWPVKVYSDINEACKGTHAIMCLRLQLERQQAGLLPDTREY
SRYFGLGYRQMELASPDVKVMHPGPMNRGVEISSELADSAASLVLDQVASGVATRMALLY
LYLTRQKQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaatggcagcataaggatttgctggatattacccagctcaataaagaggaagtgcag
catgtttttgaaacagccacttactttcaggaaatcaactcccgtccggtcaagaaggta
ccgacacttaaaggccatagcgtggtccttttttttgccgaacccagtaccagaacaaaa
gtttcttttgatatggccggtaaaagactatcctgtgatactttctcccttgctaaaagt
tcaagcagtctgaccaaaggtgagacacttaaagataccgccctgaccttgcaggccatg
aaccctgatggaattgttctaaggcactgggccagcggatcggcagcattccttgctgag
cgactcgattgcagcattatcaatgccggagacggccgtcatgcccaccccacacaagcc
ctgctggacggctttaccctctatcaggaatggggaagccttgaaggtaaaacagtactc
attctcggcgatatcgcccatagcagggttgcccgttccaatgtgatcctgctgaccatg
atgggcgcaaaagtacgcctttgcggtccgcgcactctgctgcctccataccttaaaaac
tggccggtcaaagtatactccgacattaatgaggcctgcaaagggactcatgccatcatg
tgcctgcgcttgcagcttgaacgccagcaggcgggactgcttcctgatacccgtgaatat
tccagatatttcggtcttggctacagacagatggagcttgcctcccctgatgttaaggtt
atgcatcccggtcccatgaacagaggcgttgaaatcagttctgaacttgctgactctgcg
gcgagccttgtacttgatcaggttgccagcggtgtcgccacccgtatggctcttctttat
ctctacctaacccgccaaaaacaataa

DBGET integrated database retrieval system