KEGG   Desulfovibrio hydrothermalis: DESAM_21879
Entry
DESAM_21879       CDS       T02428                                 

Definition
(GenBank) Type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
dhy  Desulfovibrio hydrothermalis
Brite
KEGG Orthology (KO) [BR:dhy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dhy02044]
    DESAM_21879
Secretion system [BR:dhy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DESAM_21879
SSDB
Motif
Pfam: T6SS_VipA Glyco_transf_20
Other DBs
NCBI-ProteinID: CCO24152
UniProt: L0RD50
Position
2268541..2269023
AA seq 160 aa
MAKEGSVAPKERVNIVYKPETGNAKEEVELPLKLLVIGDFSQKDDDSMVEDRDPVNIDKD
NFNEVLKAQDLELTLGVDNKLTDEADAQMAVNLKFESLKDFDPDRIIKQVPELQKLMELR
EALKALKSPLSNVPEFRKKVQSLVKDAGARERLLKELGIE
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcaaaagaaggctcagtagcccccaaagaaagggtgaacatagtttataaaccggaa
acaggtaacgctaaagaagaagttgaacttcctcttaagctcttggtcattggggatttc
tcccaaaaggatgatgacagcatggtcgaggaccgtgatcccgttaacattgataaagat
aattttaacgaggtgcttaaagctcaggatctggagcttacgcttggagttgataataaa
ctcactgatgaagctgacgcacagatggctgtgaatcttaagtttgaaagtctaaaggat
tttgaccctgaccggataattaaacaggttcctgaattgcagaagcttatggaactgcgt
gaagctttaaaggcacttaaaagtccgctctccaacgtgccggagttcaggaagaaggtg
cagagtctggttaaggatgccggagcacgtgaacgtctgcttaaagaacttggaatcgag
taa

DBGET integrated database retrieval system