KEGG   Desulfovibrio hydrothermalis: DESAM_21896
Entry
DESAM_21896       CDS       T02428                                 

Definition
(GenBank) conserved membrane protein of unknown function
  KO
K11891  type VI secretion system protein ImpL
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dhy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DESAM_21896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dhy02044]
    DESAM_21896
Secretion system [BR:dhy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DESAM_21896
SSDB
Motif
Pfam: IcmF-related_N MFS_1 DUF4191
Other DBs
NCBI-ProteinID: CCO24169
UniProt: L0RBN2
Position
2290697..2294209
AA seq 1170 aa
MKKLILQILKALFYVLLFVAAAVASYALVTYKGWPWWAGACLFGGVIGFVVAILFMRKWF
LRRRERKFVKRIVDQDDSAIAAAPVHERARLQDLQTRWMDAVELLRSSELRKRGNPLYVL
PWYMVFGESDSGKTTAVASSRLTTILTDVGPVPGVSATKNCDWWFFEEAIILDTAGRYAI
PLDESRDKEEWERFLTLLVKYRKKEPLNGLIVTVPADRLLGGDEDGLAEYGRSLRRRINE
LMRVLGVRFPVYVLITKMDLVFGLKGLTEVLPEYTHSQAMGLVNETMMADPEEFVDKAIL
SVTERLRELRLLLLDSSSRFDPAFLLFSEELDRLRPRIKAFAVGAFEDNPYQELPLFRGM
FFSSGEQTGEQSSEFISGLSSLKNVEKKLPKTARGLFLHDFFSKILPRDRNLFTPILEFL
KWKLLTRNMGMGVWLLILFFLSGLFSLSYIANQRAMNDLFVAFPEKPVFSEKVDEKIVQI
DGFRKKILDLHNLNSDWWIPRMGLEVSNEAEFEIKKLYCQDVESLLLKPMDEQLDSAVNK
LDVKSTEQLTSSFIKLLVWRIDLIKNRLSTGTRKPLSDFELPSGRAMSTAIEGFNPDLMK
YFGELYGSYLEWNDNTEGLSEQKMLLQARLGKVFSLKGSDFKWLVDWINDNPELEPVTLQ
DFWGGPQLLLKNEIYVAPAYTQSGHKMLQGFLAELKDAMQDVGEFDKKEKAFWVWYAGEY
YKIWFNFAEHFADGKKQLLTKNDYRDMAAKMALPNNPYFRLLTQMKDEFSPIKKIITPPD
WVNQVLYFNVVLAQYKASKAKGVEESSEKAQDSLRKIVAEFGGKIAQDVEQRIEVAKRLD
GYINVLDDVSAFTDTQEKAFKSAAALFPGSGGSPGGSSGGGSSGASGSAALKKNPVEGAT
QAMSALKAHMNSEGRGSDMFWHLVAGPLDFIVYVIISEASCELQQLWEGQVLAEVAHVPS
NKLRENLFGKTGVVNKFITGTAKPFLSRDTKGWRSKVWMGIPFPFKDDFFTFLNDGARGS
QEIQPEYKVTLSTLPTSVNTNATQEPYSTILTVECGSAQQVLSNFNYAEEMLFTWKPEDC
GTTTLTIKFPGLSLTRSYDGKLGFAKFLGEFRGGVMTFTPKDFPQQEKALIDLGVETVKV
GYAFKGAAPVIELLDIKPLNIPDNISNCWQ
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgaagaaactaattctacagatactcaaggctctcttttacgtgctgctttttgtcgcg
gcagcggtggcctcttatgcactggttacttataaaggctggccgtggtgggccggagct
tgtcttttcggcggggttatcggttttgttgttgcgattctttttatgcgtaaatggttt
ttgcgtagacgcgaaaggaaatttgtcaagcgtattgtcgatcaggatgattctgccatt
gcagcagctccggttcatgaaagggcacgtttgcaggatctgcaaacaaggtggatggat
gctgtggaacttttgcgttcttcagaactgcgtaagcgtggtaatccgctttatgttttg
ccttggtatatggtttttggcgagtctgattctggtaaaaccacagcggtggccagcagc
aggctgactactattcttaccgatgtagggcctgtgccgggtgtttctgctaccaagaat
tgcgactggtggttttttgaagaggctataattttagataccgcaggtcgctatgccatt
ccgcttgatgagtcacgtgacaaagaggaatgggagagatttcttacgcttttggttaag
tatcgtaaaaaagaaccgcttaacggtttgattgttacggtccccgctgacaggctgtta
ggcggcgatgaagacggacttgccgagtatggacgcagtctcagacggcgtatcaatgag
cttatgcgtgtacttggggtgcgttttccggtttacgtgctgattaccaagatggatctt
gttttcggacttaaaggactgaccgaagttctgccggaatatacacactctcaggctatg
gggctggttaatgaaactatgatggctgaccctgaagagttcgtggataaagccatactc
agcgtaacagagagattgcgtgaactcaggttgcttctgcttgacagcagcagtcgtttt
gatcccgcttttctgcttttttcagaggaacttgaccgtttgcgtccacggatcaaggcg
tttgccgtcggagcctttgaagacaatccatatcaggaactgccattgtttcgggggatg
ttcttttccagtggtgaacagaccggcgaacagagttcagaatttatcagcggactttct
tcacttaaaaatgttgaaaaaaagttgcctaaaactgcacgcggtctcttcctgcatgac
tttttttctaaaatactgcctcgcgaccgtaatttattcacgcctattcttgagtttctt
aaatggaagcttttgaccagaaatatgggaatgggtgtctggctgctgattctgtttttt
ttgagcggtcttttcagtctgtcatatatcgccaaccagagggctatgaatgatctcttt
gttgcttttccggaaaaacctgttttttcggaaaaggtcgacgagaagattgttcaaatt
gatggattcaggaagaaaatccttgatttgcacaatcttaattctgactggtggattcca
cgtatgggccttgaggtcagtaatgaagctgaatttgaaataaaaaaattgtactgtcag
gacgtagaatctcttcttcttaagcccatggacgaacagctcgattcagctgtcaataaa
ctggatgttaaatctacggaacagcttaccagttcttttataaaacttttggtctggcgg
attgatttaataaaaaatcgtttaagcactggaacaagaaagccattatccgactttgag
cttccctcgggcagggctatgtcaactgcgatagagggattcaaccccgatttgatgaaa
tattttggtgaattgtatggttcatatcttgagtggaatgataataccgaaggtctctct
gagcagaagatgttattacaggcccggctgggaaaagttttcagtctcaaaggttctgat
ttcaagtggctggtggattggataaatgacaatcccgagctggagccggttactttgcag
gatttttggggcggtccgcaattgcttttgaaaaatgaaatatatgtcgctccagcgtat
actcagtccggtcataaaatgttgcagggctttcttgctgagcttaaagacgcgatgcag
gatgtaggtgaatttgataaaaaagaaaaggccttctgggtctggtatgcaggtgaatat
tataaaatctggtttaactttgcagagcactttgctgatggcaaaaaacagcttctgacc
aagaatgattaccgtgacatggctgctaaaatggcattgccgaataatccttatttccgt
ttacttactcagatgaaagatgaattcagtcctattaaaaaaattataacccctccggac
tgggttaatcaggttttatattttaatgtagttctagcgcaatacaaggccagcaaggcc
aaaggtgttgaagagtcctctgagaaagctcaggattcacttagaaaaatagtggccgaa
ttcggtggaaaaatagctcaggatgttgaacagcgtatagaagttgctaagaggcttgat
ggttatattaacgttcttgatgatgtttccgcctttactgatacgcaagaaaaagccttt
aagagtgccgcggccctttttcccggttcagggggaagtccgggcggttcttccggcgga
ggttcaagcggggcatcgggtagtgctgcgttgaaaaaaaatcctgtcgaaggagcaact
caggcaatgtctgcgcttaaagctcacatgaacagcgaaggtcgcggttccgatatgttc
tggcatctggttgccggtccgcttgattttatagtctatgtaatcatatccgaagcttcc
tgtgaattgcagcagttgtgggaagggcaggtgcttgctgaggttgcgcatgttccaagt
aataagcttagggaaaatctttttggcaaaaccggagtggtaaataagtttattactggt
acggccaagccttttctgtctcgcgataccaaaggatggcgcagtaaggtctggatgggc
atcccgtttccgtttaaggatgacttctttactttcttaaatgacggcgcacgcggcagt
caggagattcagcccgaatacaaggtcaccctttccacccttccgacttcggtaaatacc
aatgcgacgcaggaaccatattcaacaatacttaccgtggagtgcggcagtgcacagcag
gttttgtctaatttcaactatgcagaggaaatgctttttacctggaagccggaagactgc
ggaacaactacgctgacaatcaagtttcccggactcagtcttacccgcagttatgatgga
aagcttggttttgcaaagtttcttggtgaattccgtggcggggtaatgacatttactcct
aaggattttccgcagcaggagaaggctttaatcgaccttggcgtagagaccgtgaaggtt
ggctatgctttcaagggagcggctccggtcatcgaattacttgatattaaacccctaaat
attcctgacaacatttcgaactgctggcaataa

DBGET integrated database retrieval system