KEGG   Desulfovibrio hydrothermalis: DESAM_22288Help
Entry
DESAM_22288       CDS       T02428                                 

Definition
(GenBank) Siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00860  Porphyrin and chlorophyll metabolism
dhy01100  Metabolic pathways
dhy01110  Biosynthesis of secondary metabolites
dhy01120  Microbial metabolism in diverse environments
Module
dhy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dhy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DESAM_22288
Enzymes [BR:dhy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     DESAM_22288
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     DESAM_22288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M ThiF Shikimate_DH CysG_dimeriser
Motif
Other DBs
NCBI-ProteinID: CCO24555
UniProt: L0RED9
Position
complement(2689863..2690540)
Genome map
AA seq 225 aa AA seqDB search
MTYYPIFLKVKNRKCLLVGAGAVGVRKLKSLLECDPANVTVLDTAEPSAEMHEICRDKRV
DFEKRPFFPDDLDDKFMALACTSNTAVNRQIADLCEKNNILCNIADFPDGSNFIVPSVIR
QGDLTLAVSTGGSSPAFTKKVRRELQNVFGPHYASFITLMGRIRPMVLDLGKETSQNTAL
FRQLVASPILDELEAGNLDRVTEILTQNLPDELVPRIPELTDDLI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacctactaccctatttttctaaaagtgaaaaaccggaaatgcctgctggtcggtgcc
ggtgctgtaggagtccgcaaactcaagtcattgcttgaatgcgaccctgcaaatgtaacc
gtgcttgacaccgcagaacctagtgctgaaatgcatgaaatctgccgggataaacgggtt
gattttgaaaaacgaccttttttccctgatgatcttgatgataaatttatggcactggcc
tgcaccagcaacactgccgtgaatagacaaatcgcagatttatgtgaaaagaacaacatt
ctctgtaatatcgcagactttcctgatgggagcaattttattgttccttccgttatccgg
cagggagacttgactctggctgtctcgactggtggcagctctcccgcttttaccaaaaag
gtccgccgtgaattgcagaatgttttcgggccgcattatgcctctttcatcactttaatg
ggaagaatcagaccgatggtccttgacctcggcaaggaaacaagccaaaacaccgcttta
ttcagacagcttgttgcatctccgattctagatgaactggaagcaggaaacttggatcgg
gtcacggaaatactgacccaaaacctgcctgatgaacttgttccccgtataccggagtta
actgatgaccttatttga

DBGET integrated database retrieval system