KEGG   Acidovorax ebreus: Dtpsy_0032Help
Entry
Dtpsy_0032        CDS       T00853                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dia  Acidovorax ebreus
Pathway
dia00071  Fatty acid degradation
dia00072  Synthesis and degradation of ketone bodies
dia00280  Valine, leucine and isoleucine degradation
dia00310  Lysine degradation
dia00362  Benzoate degradation
dia00380  Tryptophan metabolism
dia00620  Pyruvate metabolism
dia00630  Glyoxylate and dicarboxylate metabolism
dia00640  Propanoate metabolism
dia00650  Butanoate metabolism
dia00900  Terpenoid backbone biosynthesis
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
dia01212  Fatty acid metabolism
dia02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dtpsy_0032
   00630 Glyoxylate and dicarboxylate metabolism
    Dtpsy_0032
   00640 Propanoate metabolism
    Dtpsy_0032
   00650 Butanoate metabolism
    Dtpsy_0032
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dtpsy_0032
   00072 Synthesis and degradation of ketone bodies
    Dtpsy_0032
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dtpsy_0032
   00310 Lysine degradation
    Dtpsy_0032
   00380 Tryptophan metabolism
    Dtpsy_0032
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtpsy_0032
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dtpsy_0032
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dtpsy_0032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dia04147]
    Dtpsy_0032
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dtpsy_0032
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dtpsy_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACM31521
UniProt: B9M9V0
Position
complement(36938..38125)
Genome map
AA seq 395 aa AA seqDB search
MTHREVFVVSTARTAIGTFGGSLKDVPNTQLATTAVKAAIARAGIAPDAVGHVVMGNVIP
TDTKDAYLSRVAAIDAGCPIETPAFNVNRLCGSGLQAIISAAQAIGYGDCDVAVGGGSES
MSRGPYFDQGARWGQRMGDSKSIDYMLGILHDPWQKMHMGITAENVAERYQISREMQDQL
ALASQQRAAAAIAAGYFKEQIVPVEIATRKGTVLFQEDEHVRAATTLDVLAGMKPAFKKE
GGTVTAGNASGINDGAAAVVLVAGDRLQALNVKPLARLVGYAHAGVDPAYMGIGPVPATQ
KVLQRTGLKVQDMDVIEANEAFAAQACAVVQELGLDPAKVNPNGSGISLGHPVGATGAII
TTKAIAELHRTGGRYALVTMCIGGGQGIAAIFERV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccgcgaagtcttcgtcgtcagcaccgcccgcaccgccatcggcaccttcggc
ggcagcctgaaggacgtgcccaacacccagctcgccaccaccgccgtgaaggccgccatc
gcgcgcgccggcatcgcgcccgacgccgtgggccatgtggtgatgggcaacgtgatcccc
accgacaccaaggacgcgtacctgagccgcgtggcggcgattgacgccggctgccccatc
gagacgcccgccttcaacgtcaaccggctgtgcggctcgggcctgcaggccatcatcagc
gcggcgcaggccattggctatggcgactgcgacgtggccgtgggcggtggctcggaatcc
atgagccgcggcccctacttcgaccagggcgcgcgctggggccagcgcatgggcgacagc
aagagcatcgactacatgctcggcatcctgcacgacccctggcagaagatgcacatgggc
atcaccgccgagaacgtggccgagcgctaccaaatttcgcgcgagatgcaagaccaactc
gccctggccagccagcagcgcgccgccgccgccatcgccgccggctacttcaaggaacag
atcgttcccgtggaaatcgccacgcgcaagggcaccgtgctgttccaggaagacgaacat
gtgcgcgccgccaccacgctggacgtgctggccggcatgaagcccgcgttcaagaaggaa
ggcggcacggtcacggccggcaacgcctcgggcatcaacgacggcgcggctgccgtggtg
ctggtggcgggcgaccgcctgcaggcgctgaacgtgaagcccttggcgcgcctggtgggc
tatgcgcacgccggcgtggaccctgcctacatgggcatcggccccgtgcccgccacgcaa
aaggtgctgcagcgcaccggcctgaaggtgcaggacatggatgtgatcgaagccaacgag
gccttcgccgcccaggcctgcgccgtggtgcaggagctgggcctggaccccgccaaggtc
aaccccaacggctcgggcatttcgctgggccaccccgtgggtgccacgggcgccatcatc
accaccaaggcgattgccgagctgcaccgcacgggcgggcgctacgcgctagtgaccatg
tgcatcggcggcggccaaggcatcgcggccatcttcgagcgggtttga

DBGET integrated database retrieval system