KEGG   Acidovorax ebreus: Dtpsy_0642
Entry
Dtpsy_0642        CDS       T00853                                 

Definition
(GenBank) general secretion pathway protein F
  KO
K02455  general secretion pathway protein F
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0642
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0642
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0642
SSDB
Motif
Pfam: T2SSF
Other DBs
NCBI-ProteinID: ACM32122
UniProt: B9MD90
Position
complement(665540..666769)
AA seq 409 aa
MPAYSFEALDAQGHVRRGTLEADSPKAARSLLRAQALVPLDVEALAAGTAPGTPPTLAQR
LFTRPVFNATGLGVWTRQLAGLVGSGLPLERALTALAEEADDERQRHLLAALRAEVNAGS
TFARALAQHPREFSDIYCAVIGAGESSGGLAEVLDSLADDLEQRQALRAKLIGAALYPAI
VTVIAIVIVLFLVGYVVPQVASVFAGTKRALPFLTVAMLALSDVVRNYGWALLGGLVLLA
FGARAALAQPRLREKFDAAWLRLPLVGKLARGYNAARFAGTLAMLAGAGVPILKALQAAA
ETLNNRALRADALDALVLVREGAPLASALAQKKRFPGLVAMFARLGEQTGQLPTMLQRAA
TQLGTEVQRRAMQLATVLEPLLIVAMGGIVMLIVLAVLMPIIQLNQFVK
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcccgcctattccttcgaagccctggacgcccaaggccatgtgcgccgcggcaccctg
gaggccgacagccccaaggccgcccgcagcctgctgcgcgcccaggccctggtgcccctg
gatgtggaagcgctggccgctggcaccgcccccggaacaccccccacgctggcgcagcgg
ctgttcacgcggccggtgttcaacgccacggggctgggcgtgtggacgcggcagctcgcc
gggctggtgggctcgggcctgccgctggagcgtgcgctgaccgcgctcgccgaagaggcg
gacgacgagcgccagcgccacctgctggccgcgctgcgcgccgaggtcaacgccggctcc
accttcgcacgcgcgctggcgcagcacccgcgcgagttctccgacatctactgcgccgtg
atcggcgcgggcgagtccagcggcggcctggccgaagtgctggacagcctggcggacgat
ctggagcagcgccaggccttgcgcgccaagctcatcggcgctgcgctgtacccggccatc
gtcaccgtgatcgcgatcgtcatcgtgctgttcctggtgggctacgtggtaccgcaggtg
gccagcgtattcgcgggcaccaagcgcgccctgcccttcctcacggtggccatgctggcc
ttgagcgacgtggtgcgcaactacggctgggcgttgctgggcgggctggtcctgctggcg
ttcggcgcccgcgccgcgctggcccagccgcggctgcgcgagaagttcgacgccgcctgg
ttgcgcctgccgctcgtcggcaagctggcgcgcggctacaacgcggcgcgtttcgccggc
acattggccatgctggcaggcgcgggcgtgcccattctcaaggcgctgcaggccgcggcc
gagacgctgaacaaccgcgccctgcgcgcggacgcactcgacgcgctggtgctggtgcgc
gagggcgcgccgctggcctcggcactggcgcagaaaaagcggttccccggcctggtggcc
atgttcgcgcggctgggcgaacagacgggccagttgcccaccatgctgcagcgcgccgcc
acgcaattgggcaccgaggtgcagcgccgcgccatgcaactggccacggtgctggagccg
ctgctcatcgtggccatgggcggcatcgtgatgttgatcgtgctggcggtgctcatgccg
atcatccagctcaaccagttcgtcaaatga

DBGET integrated database retrieval system