KEGG   Acidovorax ebreus: Dtpsy_0645
Entry
Dtpsy_0645        CDS       T00853                                 

Definition
(GenBank) general secretory pathway protein E
  KO
K02454  general secretion pathway protein E [EC:7.4.2.8]
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0645
Enzymes [BR:dia01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Dtpsy_0645
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0645
SSDB
Motif
Pfam: T2SSE AAA_16 AAA_22 NTPase_1 AAA_29 AAA_30 AAA_14 AAA_23 AAA ResIII AAA_19 Rad17 AAA_18 ATPase_2 AAA_7 AAA_11 ABC_tran Zeta_toxin AAA_5 SRP54 cobW AAA_21 TK DUF927 AAA_8 UvrD-helicase
Other DBs
NCBI-ProteinID: ACM32125
UniProt: B9MD93
Position
complement(668714..670102)
AA seq 462 aa
MRHPLPYAFARSSQLLLEDDGQQLVLWHGPQPDAGALSEVLRKHAVHQFMPLDAPTLAQR
ISAAYSQSESSAATVVSEVEEGADLSRMMQELPAVEDLLESAGDAPIIRMLNALLTQAVR
DGASDIHIEPYERHSSVRFRVDGTLREVVQPNRALHAALISRLKIMADLDISEKRLPQDG
RISLRLGTRAVDVRVSTLPNAHGERAVLRLLDKSESKLNLEAVGMQGEVLARLAHLIQQP
HGIILVTGPTGSGKTTTLYAALARLDAARSNIMTVEDPIEYELPGVGQTQVNAKIDLTFA
KALRAILRQDPDVIMIGEIRDFETAQIAIQASLTGHLVLATLHTNDAASAITRLTDMGVE
PFLLSSSLLGVLAQRLVRKYCGECHGAGCEHCGHTGYAGRTGVFELLVVDDAIRAQIHNQ
APEAEVRTQALAGGMTLMRDDGERLIHAGITSREEVLRVTRD
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcgccaccccctgccctacgcatttgcgcgcagcagccagctgctgctggaagacgac
ggccagcagctcgtgctgtggcacggcccgcagccggacgccggcgcgctgtccgaagtg
ctgcgcaagcatgccgtgcaccagttcatgccgctggacgcacccacgctggcgcagcgc
atcagcgcggcgtattcgcaaagcgaatccagcgcggccacggtggtgagcgaggtggaa
gaaggcgccgacctctcgcgcatgatgcaggagctgcccgcggtggaagacctgctggag
tccgcgggcgacgcgcccatcatccgcatgctcaacgccctgctcacgcaggccgtgcgc
gacggcgcgagcgacatccacatcgagccctacgaacgccattccagcgtgcgctttcgc
gtggacggcacgctgcgcgaggtggtgcagcccaaccgcgcgctgcacgccgcgctgatc
agccgcctgaagatcatggcggacctggacatctccgaaaagcgcctgccgcaggacgga
cgcatcagcctgcgcctgggcacccgcgccgtcgacgtgcgcgtatccacgctgcccaac
gcccatggcgagcgcgccgtgctgcgcctcttggacaagagcgagagcaagctgaacctg
gaggccgtgggcatgcagggcgaggtgctggcgcggctcgcgcacctgatccagcagccg
cacggcatcatcctcgtgaccggccccacgggctcgggcaagaccaccacgctgtacgcg
gcgctggcgcggctggacgccgcgcgcagcaacatcatgacggtggaagaccccatcgag
tacgagttgcccggtgtgggccagacgcaggtcaatgccaagatcgacctgacgtttgcc
aaggccctgcgcgccatcctgcgccaggaccccgatgtgatcatgatcggcgagatccgc
gacttcgagaccgcgcagatcgccatccaggcctcgctcaccggccacctggtgctggcc
acgctgcacaccaacgacgcggccagcgccatcacgcgcctgaccgacatgggagtggag
ccgttcctgctgtcctcgtcgctgctgggggtgctggcgcagcgcctggtgcgcaaatat
tgcggcgagtgccacggtgcaggctgcgagcactgcggccataccggctacgcggggcgc
accggcgtgttcgaactgctggtggtggacgacgccatccgcgcacagatccacaaccag
gccccggaggccgaggtgcgcacccaggccctggccggcggcatgacgctgatgcgcgac
gatggcgagcggctgatccacgccggcatcaccagccgcgaagaagtgctgcgtgtgacg
cgcgactga

KEGG   Acidovorax ebreus: Dtpsy_2747
Entry
Dtpsy_2747        CDS       T00853                                 

Definition
(GenBank) type II secretion system protein E
  KO
K02454  general secretion pathway protein E [EC:7.4.2.8]
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_2747
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_2747
Enzymes [BR:dia01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Dtpsy_2747
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_2747
SSDB
Motif
Pfam: T2SSE T2SSE_N AAA_16 Rad17 AAA_22 AAA_25 AAA_29 AAA_23 AAA_19 AAA_30 AAA_7 AAA_11 AAA_18 AAA_14 cobW NTPase_1 AAA ResIII ABC_tran Zeta_toxin ATPase_2
Other DBs
NCBI-ProteinID: ACM34181
UniProt: B9MEE2
Position
complement(2926461..2928257)
AA seq 598 aa
MTAEALPASPPTAAGGPTGPLQWRLIVDWLRADGVITAEQAQRTIARCSQAESSQHPLVR
LGNVAMLRASDGKPLDVDILTEYVAQRCGLAFLRIDPLKVDVGRVADAMSASYAERHKVL
PVQVTSKEVVVATAEPFLHDWVAEVERQSRRTVRRVLANPQHITRYTAEFYALAKSVREA
QKAGGGAAGSSFEQLVELGKTNKQLDANDQGVVRVVDWLWQYAFDQRASDIHLEPRREQG
VIRFRIDGVLHAVYQMPMGVLNAMVARVKLLGRMDVVEKRRPQDGRIKTRNPRGDEVEMR
LSTLPTAFGEKMVMRIFDPDNAVKDLDALGFTAHDAQRWEQLVKRPHGIILVTGPTGSGK
TTTLYSTLKRVATEEVNVSTVEDPIEMIEPSFNQTQVQPQLDFTFAEGLRALMRQDPDVI
MVGEIRDLATADMAVQAALTGHLVFSTLHTNDAPSAVTRLMELGVPPYLINATLLGVLAQ
RLVRTLCRHCRQVDEAADPEALADMIRPWKINGGYRAYKPVGCVECRMTGFRGRMGLYEL
LTVSEALKTQVNQSPSIDALRRQAVQDGMRPLRLAGALRAAEGVTTFEEVIAATPPLE
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgactgccgaagcattgcccgcatccccccccacggccgccggcgggcccaccggcccg
ttgcagtggcggctcatcgtcgattggctgcgtgccgatggcgtgatcaccgccgagcag
gcgcagcgcaccatcgcacgctgctcgcaggccgaaagcagccagcacccgctggtgcgg
ctgggcaacgtggccatgctgcgcgccagcgacggcaagccgctggacgtggacatcctc
accgaatacgtggcccagcgctgcggcctggcgtttctgcgcatcgacccgctgaaggtg
gacgtgggccgtgtggccgacgccatgagcgcgagctacgccgagcgccacaaggtgctg
ccggtgcaggtgacctccaaggaggtggtggtggccacggccgagcccttcctgcatgac
tgggtggccgaggtggagcgccagtcccggcgcacggtgcggcgcgtgctggccaacccc
cagcacatcacgcgctacacggcggagttctatgcgctggccaagtcggtgcgcgaggcg
cagaaggccggcggcggcgccgcgggcagcagcttcgagcagctcgtggagctgggcaag
accaacaagcagctggacgccaacgaccagggggtggtgcgcgtggtggactggctgtgg
cagtacgccttcgaccagcgcgcgagcgacatccacctggagccgcgccgcgagcagggc
gtgatccgctttcgcatcgacggcgtgttgcatgccgtctaccagatgcccatgggcgtg
ctcaatgccatggtggcgcgcgtgaagctgctgggccgcatggacgtggtggaaaagcgc
cgcccgcaggacggccgcatcaagacgcgcaacccgcgtggcgacgaggtggaaatgcgc
ctgtccacgctgcccaccgctttcggcgagaagatggtgatgcgcatcttcgaccccgac
aacgccgtgaaggacctggacgcgctgggtttcaccgcgcacgatgcgcagcgctgggag
caactcgtcaagcgcccgcacggcatcatcctggtgaccgggcccacgggttcgggcaag
accactacgctgtactccaccctgaagcgcgtggccaccgaggaggtgaacgtgagcacg
gtggaggacccgatcgagatgatcgagcccagcttcaaccagacgcaggtgcagccgcag
ctggacttcaccttcgccgaagggctgcgtgccctcatgcgccaggacccggacgtgatc
atggtgggcgagatccgcgacctggccaccgcggacatggccgtgcaggccgcgctcacc
ggccacctggtgttctccaccctgcacaccaacgacgcgcccagcgccgtcacgcgactc
atggagctgggcgtgccgccgtacctcatcaacgccacgctgctgggggtgctggcgcag
cgcctggtgcgcacgctgtgccggcactgccggcaggtggacgaggcggccgaccccgag
gcgctggccgacatgatccgcccctggaagatcaacgggggctatcgcgcctacaagccc
gtggggtgcgtggagtgccgcatgacgggctttcgcggccgcatggggctttatgaactg
ctcaccgtgagcgaggcgctcaagacccaggtgaaccaatcgccctccatcgacgcgctg
cgccgccaggccgtgcaggacggcatgcgcccgctgcgcctggcgggcgcgctgcgcgcg
gccgagggtgtgaccacgttcgaggaagtcatcgccgccaccccgccgctggagtag

DBGET integrated database retrieval system