KEGG   Acidovorax ebreus: Dtpsy_0648
Entry
Dtpsy_0648        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02462  general secretion pathway protein M
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0648
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0648
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0648
SSDB
Motif
Pfam: T2SSM
Other DBs
NCBI-ProteinID: ACM32128
UniProt: B9MD96
Position
complement(673293..673838)
AA seq 181 aa
MNTRPASTSPAPVPPALAALRAHWARMAPREQSLVLAAAAVVGLALLWWVLLAPALQQLR
GSGARHAAVDAQLQRMQALQAEALQLKDAPRPPGGEALRTLQTTLTQQLGAAAQMNVAGD
RATVTLKGAPAEALAQWLNQARSTARAVPLEARLVHSAAPANAAAGAVRWDGTLVLALPP
Q
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaacacccgccccgcttcgacctcgcccgcgccggttccccctgcgctggccgcgctg
cgcgcccactgggcccgcatggcgccgcgcgaacagtccctggtgctggccgccgcggcc
gtggtggggctggccctgctgtggtgggtgctgctggcgcccgcactgcagcagctgcgc
ggctcgggcgcacgccacgcagccgtggacgcgcaactgcagcgcatgcaggccctgcag
gccgaagcgctacagctcaaggacgcgccccgcccacccggcggcgaggccctgcgcacg
ctgcagaccacgctgacgcagcaattgggcgcagccgcgcagatgaacgtcgcgggcgac
cgcgccaccgtcaccctcaagggcgcccccgccgaggcccttgcccagtggctgaaccag
gcgcgcagcaccgcgcgcgccgtgccgctggaagcccgcctggtgcacagcgccgcgccc
gccaacgccgccgcgggcgctgtccgctgggacggcacgctggtgctggcgctgcccccg
caatag

DBGET integrated database retrieval system