KEGG   Acidovorax ebreus: Dtpsy_0650
Entry
Dtpsy_0650        CDS       T00853                                 

Definition
(GenBank) general secretion pathway protein K
  KO
K02460  general secretion pathway protein K
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0650
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0650
SSDB
Motif
Pfam: T2SSK HHH_3
Other DBs
NCBI-ProteinID: ACM32130
UniProt: B9MD98
Position
complement(675124..676071)
AA seq 315 aa
MLTVTLVATFAAAAMWQQWRAIEVETAERARIQSAWILIGALDWSRLILREDSIARSGDG
TDNLSEPWSVPLEEARLSTFLAADRNVAQVEDASTDTTNAFLSGQITDLQALLNLRNLAN
EGQVDATALRQFQRLFEYLGLPRAQLDMLARQMLRAEAKDSDSASAAPLLPQSVAQLGWW
GLPQRSVDALAPYVTLLPVRTKVNLNTASAVVLWASADGLDMAEAQHLVQARDSNHFRSE
VDAAKLLGNSSRISATVHTVSSSYFEVRGRLRLDMAVVEERSLVYKQRGDVRTLWRERGG
LVRTTAPGTAAAGAR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgctcaccgtgacgctggtcgccacgttcgcggccgcggccatgtggcagcagtggcgc
gccatcgaagtcgaaaccgccgagcgcgcacgtatccagtcggcgtggatcctgatcggt
gcgctggactggtcccgcctgatcctgcgcgaagactccattgcccgcagcggcgacggc
accgacaacctctccgaaccctggtcggtgccgctggaagaagcgcgcctgtccacgttc
ctcgcggccgaccgcaatgtggcccaggtggaagacgcgagcaccgacaccaccaacgcc
ttcctgtcgggccagatcaccgacctgcaggccctgctgaacctgcgcaacctggccaac
gaggggcaggtggacgccacggcgctgcggcaattccagcggctcttcgaatacctcgga
ctgccgcgcgcacagctggacatgctggcgcggcagatgctgcgcgccgaggccaaggac
agtgactccgcgagcgccgcgccgctgctgccgcaaagcgtggcgcaacttgggtggtgg
ggcctgccgcagcgcagcgtggatgcgctcgcgccctacgtcacgctgctgcccgtgcgc
accaaggtcaacctcaacaccgccagcgccgtggtgctgtgggccagcgccgacgggctg
gacatggccgaggcgcagcacctggtgcaggcacgcgactccaaccacttccgcagcgag
gtcgacgccgccaagctgctgggcaactccagccgcatctcggccacggtgcatacggtg
tcgtccagctacttcgaagtgcgcgggcgactgcgcctggacatggccgtggtcgaagag
cgctcgctggtctacaaacagcgtggggacgtgcgcacgctgtggcgcgaacgtggcggc
ctcgtgcgcacgacggctcccggcactgcggccgctggcgcgcggtga

DBGET integrated database retrieval system