KEGG   Acidovorax ebreus: Dtpsy_0651
Entry
Dtpsy_0651        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02459  general secretion pathway protein J
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0651
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0651
SSDB
Motif
Pfam: N_methyl T2SSJ
Other DBs
NCBI-ProteinID: ACM32131
UniProt: B9MD99
Position
complement(676254..676931)
AA seq 225 aa
MQAARGFTLVELLVAIAVMALLAIASWRGLDGMARSQQLTRERTDELLVLQTVLAQWAAD
LDALQAIDHTEPIAWDGQVLRLTRRGTRQPDEGALVVAWARRSVDGTARWLRWQSPPVRT
RAEWNAAWQRAAQWARTPGEAERRQETVLMPLANWQLYYYRSGAWANALSTDTSASAPRT
VGGLSSAAASIPEGVRLQLTLPPGGALSGVVTRDWANPLLGGGKS
NT seq 678 nt   +upstreamnt  +downstreamnt
atgcaagcagcgcgcggcttcacgctggtggagctgctcgtggccatcgcggtaatggcg
ctgctcgccatcgccagctggcgcgggctggacggcatggcgcgttcgcagcagctcacg
cgcgagcgcaccgacgagctgttggtgctgcaaaccgtgctggcccaatgggcggccgac
ctggatgccctgcaggccatcgaccataccgaacccatcgcctgggacggccaggtgctg
cgccttacgcggcgcggcacgcgccagcccgacgagggtgcgctggtcgtcgcctgggcg
cggcgcagcgtggacggcaccgcccgctggctgcgctggcagtcccccccggtgcgcacc
cgcgcggaatggaatgccgcctggcagcgcgcagcccagtgggcgcgcacacccggcgag
gccgagcgccgacaggaaaccgtgctgatgccgctggccaattggcagctgtactactac
cgcagcggcgcctgggccaatgcgctgtccaccgataccagcgccagcgcaccgcgcacg
gtcggcgggctgagcagcgccgccgccagcatccccgagggggtgcgcctgcaactcacg
ctgccgccgggtggcgcactctcgggcgtggtcacgcgggactgggccaatccgctgctg
ggtggaggcaagtcgtga

DBGET integrated database retrieval system