KEGG   Acidovorax ebreus: Dtpsy_0652
Entry
Dtpsy_0652        CDS       T00853                                 

Definition
(GenBank) general secretion pathway protein I
  KO
K02458  general secretion pathway protein I
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0652
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0652
SSDB
Motif
Pfam: T2SSI N_methyl Flavi_glycoprot
Other DBs
NCBI-ProteinID: ACM32132
UniProt: B9MDA0
Position
complement(677083..677481)
AA seq 132 aa
MSHRARTGTGARRRHGAARGFTLVEVLVALGIVAIALMAGLQATSALTRNAARQTNVVLA
HLCAENELSRVRLSSQMPSIGDTRVACEQAGRRYDVAVTVSPTPNPQFRRVDAQVFEATL
PVLRLSTIVGRY
NT seq 399 nt   +upstreamnt  +downstreamnt
atgagccaccgcgcgcgaacgggcacgggggcgcggcgccggcacggagcggcgcgcggc
ttcacgctggtggaggtgctggtggcactgggcatcgtcgccatcgccctcatggcaggg
ctgcaggccacctccgccctcacgcgcaacgccgcgcgccagaccaacgtggtgctggcc
cacctgtgcgccgagaacgagctgagccgggtgcgcctgtcgtcgcagatgccgtccatc
ggcgacacgcgcgtggcctgcgagcaggcgggtcggcgctacgacgtggcggtgacggtt
tcgcccacacccaatccacagttccgccgcgtggacgcgcaggtcttcgaggcaacgctg
cccgtgctgcggctgtccaccatcgtggggcggtattga

DBGET integrated database retrieval system