KEGG   Acidovorax ebreus: Dtpsy_0654
Entry
Dtpsy_0654        CDS       T00853                                 

Definition
(GenBank) general secretion pathway protein G
  KO
K02456  general secretion pathway protein G
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0654
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0654
SSDB
Motif
Pfam: T2SSG N_methyl FGFR3_TM
Other DBs
NCBI-ProteinID: ACM32134
UniProt: B9MDA2
Position
complement(678060..678539)
AA seq 159 aa
MSIPSRRFEMQPSPSSLAQRARRRLSAGFTLIELMVVLVIIGVLAALIVPNVLDRADDAR
STAARTDVTNIMQALKLYRLDNQRYPTAEQGLQALIAKPSAGPVPNNWRPYLEKLPNDPW
GRPYQYLSPGIKGEVDVMSFGADGQSGGEGKDADIGSWQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtccattccgagtcgccgcttcgagatgcagcccagcccttcctccctcgcgcaacgc
gcccgccgccgcctgtccgcgggcttcaccctgatcgagctcatggtggtgctggtcatc
atcggcgtgctggccgcgctgatcgtgcccaacgtgctggaccgcgccgacgacgcgcgc
agcacggccgcgcgcaccgacgtcaccaacatcatgcaggcgctcaagctctatcgcctg
gacaaccagcgctatcccacggccgaacagggcctgcaggcgctgatcgccaagcccagc
gccggcccggtgccgaacaactggcgcccctacctggagaagctgcccaacgacccctgg
ggccgcccttaccagtacctgagcccgggcatcaagggtgaggtggacgtgatgtccttc
ggcgccgatggccagtccggcggcgagggcaaggatgccgacatcggcagctggcagtaa

DBGET integrated database retrieval system