KEGG   Acidovorax ebreus: Dtpsy_0655
Entry
Dtpsy_0655        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02452  general secretion pathway protein C
Organism
dia  Acidovorax ebreus
Pathway
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0655
Secretion system [BR:dia02044]
 Type II secretion system
  General secretion pathway protein
   Dtpsy_0655
SSDB
Motif
Pfam: T2SSC
Other DBs
NCBI-ProteinID: ACM32135
UniProt: B9MDA3
Position
678563..679012
AA seq 149 aa
MVTNTYGRWAPRLATLLLWALAGATAVYWGLKLSASPAGTAPAAAAPEPVVTDTQALARL
LGASPVLAAAEAAPSAASRFVLMGVLAGTASGGGAALIAVDGKPAKPYRVGANVEPGLVL
QSLGKGAARLGASMDGATTLALEMPRKRP
NT seq 450 nt   +upstreamnt  +downstreamnt
atggtgacaaacacatacggccgctgggccccgcgcctggccacgctgctgctctgggcg
ctggcgggtgcgaccgctgtctattgggggttgaagctgtccgcaagcccggccggcacg
gcgccggcggccgcggcgcccgagccggtggtgaccgacacgcaggcgctcgcgcgcctg
ctcggggccagcccggtgctggcggccgccgaggcggcaccctccgcagccagccgcttc
gtgctcatgggcgtgctggccggcacggccagcggcggcggcgccgcgctgatcgcggtg
gacggcaagccggccaagccctaccgcgtgggcgcgaatgtggagccggggctggtgctg
cagtccctgggcaagggcgccgcgcggctgggggcgtcgatggacggcgccacgacgctg
gcgctggagatgccgcgcaagcggccctga

DBGET integrated database retrieval system