KEGG   Acidovorax ebreus: Dtpsy_0744
Entry
Dtpsy_0744        CDS       T00853                                 

Definition
(GenBank) twin-arginine translocation protein, TatA/E family subunit
  KO
K03116  sec-independent protein translocase protein TatA
Organism
dia  Acidovorax ebreus
Pathway
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_0744
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0744
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0744
Secretion system [BR:dia02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   Dtpsy_0744
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-ProteinID: ACM32223
UniProt: B9MDW9
Position
773624..773872
AA seq 82 aa
MGSFSIWHWLIVLLIVVMVFGTKKLKNIGSDLGGAVKGFKDGMKDGASTDDSATTSAPAG
QVTNNSAAADKTTIDVEAKHKS
NT seq 249 nt   +upstreamnt  +downstreamnt
atgggttcgttttccatttggcactggctcatcgtgctgctgatcgtcgtgatggtgttc
ggcaccaagaagctcaagaacatcggctccgacctgggcggcgcggtcaagggtttcaag
gacggcatgaaggatggcgccagcaccgatgactcggccaccaccagtgcgcccgcgggc
caggtgaccaacaacagcgcggctgccgacaagaccacgatcgacgtcgaagccaagcac
aagagctga

DBGET integrated database retrieval system