KEGG   Acidovorax ebreus: Dtpsy_0746
Entry
Dtpsy_0746        CDS       T00853                                 

Definition
(GenBank) Sec-independent protein translocase, TatC subunit
  KO
K03118  sec-independent protein translocase protein TatC
Organism
dia  Acidovorax ebreus
Pathway
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_0746
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0746
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0746
Secretion system [BR:dia02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   Dtpsy_0746
SSDB
Motif
Pfam: TatC
Other DBs
NCBI-ProteinID: ACM32225
UniProt: B9MDX1
Position
774447..775235
AA seq 262 aa
MSETPNKEDELAGTEQPFVQHLMELRDRLVKAMIAVGVVAAALFFYPGPGQLYDFLAAPL
VAHLPQGATMIATSVISPFMVPLKILLMSAFLVALPFVLWQVWAFVAPGLYSHEKRLVLP
LVVSSTVLFFIGVAFCYFFVFGQVFSFIQGFAPKSITAAPDIEAYLGFVMTMFLAFGLAF
EVPIAVVVLARLNVVSVEKLKSFRGYFIVVAFVIAAIVTPPDVVSQLALAIPMCLLYELG
IWAAQLFIRHTKAPEDPQESAP
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtccgaaacaccgaacaaagaagacgagctcgccggtaccgagcagcctttcgtgcag
cacctgatggagctgcgcgaccgcctcgtgaaggccatgatcgcggtgggtgtcgtcgcg
gccgccctgttcttctatcccggtcccggccagctgtacgacttcctggccgcgcctttg
gtggcccatttgccgcagggggcgaccatgatcgccacctcggtgatctcgcccttcatg
gtgccgctcaagatcctgctgatgtcggcattccttgtggcgctgcccttcgtgctgtgg
caggtgtgggccttcgtggcgccggggctgtattcgcacgagaagcgcctggtgctgccg
ctggtggtttccagcacggtgctgttcttcatcggcgtggcgttctgctacttcttcgtg
tttgggcaggtgttcagcttcatccagggttttgcacccaagagcatcactgccgcgccg
gatatcgaggcctacctgggcttcgtgatgaccatgttcctcgccttcggcttggccttt
gaggtgccgatcgccgtggtggtgctggcgcgcctgaacgtcgtgagcgtggaaaagctc
aagagcttccgcggctacttcatcgtggtcgcgttcgtgatcgccgccatcgtcacgccg
ccggacgtggtgtcgcaactggcgctggcgattcccatgtgcctgctctacgagttgggg
atctgggcggcgcagctattcatccgccataccaaggcacccgaggatccgcaggaatcc
gcgccgtga

DBGET integrated database retrieval system