KEGG   Acidovorax ebreus: Dtpsy_0759
Entry
Dtpsy_0759        CDS       T00853                                 

Definition
(GenBank) preprotein translocase, SecA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_0759
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_0759
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_0759
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_0759
Enzymes [BR:dia01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Dtpsy_0759
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_0759
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD Helicase_C DUF4897
Other DBs
NCBI-ProteinID: ACM32238
UniProt: B9MDY4
Position
786420..789173
AA seq 917 aa
MATNFLTKIFGSRNDRLLKQYRKTVARINAMEPDYEKLSDEALRGKTQEFKDRIAQGESL
DALLPEAFAVVREGSKRIMKMRHFDVQLVGGMALHYGKIAEMRTGEGKTLTATLPVYLNA
LSGQGVHVVTVNDYLAGRDAQWMGRLYNFLGLTVGINLPQMPREEKQAAYQADITYGTNN
EYGFDYLRDNMVYDARERVQRGLNYAIVDEVDSILIDEARTPLIISGQAEDHTALYVAMN
KVVPLLVRQEGEADPRTGEGVTKPGDFTLDEKTHQVFLTEQGHENAERILASQGLIPEGA
SLYDPANITLVHHLYAALRANHLYHRDQHYVVQNGEIVIVDEFTGRLMAGRRWSEGLHQA
VEAKEGVNIQAENQTLASITFQNYFRLYNKLSGMTGTADTEAYEFQEIYGLETVVIPPNR
PSKRDDQLDRVYKTTREKYEAAIADIRECHERGQPVLVGTTSIENSEIIDELLNKAGLPH
QVLNAKQHAREADIVAQAGRPGMITIATNMAGRGTDIVLGGNVEKAIAALEADESLSEAE
RAARVQELRAQWKLDHEKVTALGGLRIIATERHESRRIDNQLRGRSGRQGDPGSSRFYLS
LDDQLMRIFAGDRVKAIMDRLKMPDGEAIEAGIVTRSIESAQRKVEARNFDIRKQLLEYD
DVANDQRKVIYQQRNEILDAPDLGVLIDAMRDDCLADVVRQYVPAESVEEQWDLAGLEKA
LANDWQVSLALQKEVEGSDAITDEEILEKVQQAAREAFLAKVGQVGAENFTQFERMVLLQ
SFDTNWRDHLSALDYLRQGIHLRGYAQKQPKQEYKREAFELFRQLIDQVKNEVTRLMMTV
QVQSSAQLDEATQAMEDRGEGISNVTYSSPTETGEVETVADAATAAQPAAAGVRVGRNDP
CPCGSGKKYKQCHGKLA
NT seq 2754 nt   +upstreamnt  +downstreamnt
atggccaccaacttcctcaccaaaatattcggcagtcgcaatgaccgcctgctcaagcag
tatcgcaagacggttgctcgcatcaatgcgatggagcccgactatgaaaagctgagtgac
gaggcgctgcggggcaagacgcaggaattcaaggatcgcattgcacagggcgaatcgttg
gacgctctgctacccgaagcctttgccgtggtgcgcgagggttccaagcgcatcatgaaa
atgcgccacttcgacgtgcagctggtgggtggcatggcgctgcattacggcaagatcgcc
gagatgcgcacgggcgagggcaagacgctgacggcgacgctgcccgtttacctgaacgcc
ctatcgggccagggcgtgcacgtggtgacagtgaacgactatcttgcgggccgtgacgcg
caatggatggggcggctgtacaacttcctgggcctcacggtgggtatcaacctgcctcaa
atgccccgcgaagaaaagcaggctgcctaccaggcggacatcacctacggaacgaacaac
gagtacgggttcgactacctgcgtgacaacatggtgtacgacgcgcgcgagcgcgtgcag
cgcggcctcaactacgccatcgtcgatgaggtggactccatcctgatcgatgaggcgcgt
acccccctgatcatcagcggccaggcagaggaccacacggcgctgtatgtggccatgaac
aaggtggtgcccctgctggtgcgccaggagggtgaggccgacccgcgtacgggcgagggc
gtgaccaaaccgggggatttcaccctcgacgaaaagacgcaccaggtgttcctgacggag
cagggccacgagaatgcagagcgcatcctggccagccaggggctgattccggaaggggcg
tcgctctacgatccggccaacatcacgctggtgcatcacttgtacgcggcgctgcgcgcc
aaccatctctaccaccgcgaccagcactacgtcgtgcagaacggcgagatcgtgatcgtg
gacgagttcacgggccgcctgatggccggccgccgctggagcgaaggcctgcaccaggcc
gtcgaagccaaggaaggcgtgaacatccaggccgagaaccagacgctggcctccatcacc
ttccagaactacttccgcctctataacaagctctcgggcatgaccggtacggccgatacc
gaggcctatgagttccaggaaatctacggcctggaaaccgtggtgatcccgcccaaccgg
cccagcaagcgcgacgaccagctcgaccgcgtgtacaagacgacgcgcgagaagtacgag
gctgcgattgccgacatccgagaatgccacgagcgtggccagccggtgctggtgggtacc
acttccatcgagaactcggaaatcatcgacgagttgctgaacaaggcaggcctaccgcac
caggtactcaacgccaagcagcacgcgcgcgaggccgatatcgtggcccaggcgggacgc
cccggcatgatcaccatcgccaccaatatggcgggccgcggtaccgacatcgttctgggc
ggcaacgtggaaaaggcgatcgccgcgctggaggccgatgagtcgctgtcagaagccgag
cgagccgcgcgtgtgcaggaactgcgcgcgcagtggaagctcgaccacgagaaggtgacg
gcactcggcggcctgcgcatcatcgcgactgagcgccatgaatcccgccgtatcgacaac
cagctgcgcggccgctcgggccgtcagggcgacccgggctcttcgcgcttctatctgagt
ctggatgaccaattgatgcgcatcttcgcgggcgaccgcgtcaaggccatcatggaccgg
ttgaagatgcccgacggcgaagcgatcgaggcgggtattgtcacgcgcagcatcgagtcg
gcgcagcgcaaggttgaggcgcgcaacttcgacatccgcaaacagctgctggagtacgac
gacgtcgccaacgaccagcgcaaggtgatctaccagcagcgcaatgaaatcctggacgcc
cccgacctgggcgtgttgatcgacgccatgcgcgacgattgcctggccgacgtggtgcgc
cagtacgtgcctgccgagtccgtggaagaacagtgggacctcgcaggcctggaaaaggcg
ctggccaacgactggcaagtgtcgttggcgctgcagaaagaggtggaaggctcggacgcc
atcaccgacgaagagattctggagaaggtgcagcaggccgcccgcgaggccttcctggcc
aaggtggggcaggtgggcgcggagaacttcacgcagttcgagcgcatggtgctgctgcag
agcttcgacaccaactggcgcgatcacctctccgcgctggattatttgcgccagggcatc
cacctgcgcggctatgcgcagaagcagcccaagcaggaatacaagcgcgaggcgttcgag
ctcttccgccagctgatcgaccaggtcaagaacgaagtcacgcgcctcatgatgaccgtg
caggtgcaatccagcgcccaactggacgaggccacgcaggccatggaagaccggggtgag
ggcatcagcaacgttacctacagctcgcccaccgagaccggcgaagtggagacggtggcc
gatgccgccaccgccgcgcagcctgccgccgccggcgtgcgcgtgggccgcaacgacccc
tgcccctgcggcagcggtaaaaagtacaagcagtgccacggcaaactggcgtga

DBGET integrated database retrieval system