KEGG   Acidovorax ebreus: Dtpsy_0857Help
Entry
Dtpsy_0857        CDS       T00853                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
dia  Acidovorax ebreus
Pathway
dia00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dtpsy_0857
Enzymes [BR:dia01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Dtpsy_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ACM32335
UniProt: B9MEJ9
Position
complement(882350..882967)
Genome map
AA seq 205 aa AA seqDB search
MKLVLASNNRGKLAELQAMLAPLGVQLIPQAELGVGEAEEPFHTFVENALAKARFASAHT
GLPALADDAGLCVQAFGGQPGVQTAYYATQFGYDKGDANNVRALLEQMQGIDDRRAAMVS
TLVAVRSPQDPEPLIAVGRVAGEIARAPRGTGGFGFDPVMVLPAFGKTFAELPPEVKNAH
SHRGRSSRQMLELMREHWFAGTSER
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtactcgcctccaacaaccgcggcaagctcgccgaactgcaggccatgctg
gccccgctgggcgtgcagctcattccccaggccgaactgggcgtgggcgaggccgaggag
ccgttccacaccttcgtcgagaacgcactggccaaggcccgctttgccagcgcccacacc
ggcctgcccgcgctggcggacgacgccggcctgtgcgtgcaggcctttggcggtcagccc
ggcgtgcagacggcctactacgccacgcagttcggctacgacaagggcgacgccaacaac
gtgcgcgcgctgctggagcagatgcagggcatcgacgaccgccgcgccgcgatggtcagc
acgctggtggccgtgcgcagcccgcaggaccccgagccactgatcgccgtgggccgcgtg
gccggcgagattgcacgcgcgccgcgcggcacgggcggcttcggctttgacccggtgatg
gtgctgcccgccttcggcaagacctttgccgagctgccgcccgaggtgaagaacgcccac
agccaccgcggccgctcatcgcgccagatgctggaactgatgcgcgagcattggtttgcc
ggaacctcagaaaggtga

DBGET integrated database retrieval system