KEGG   Acidovorax ebreus: Dtpsy_0983Help
Entry
Dtpsy_0983        CDS       T00853                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dia  Acidovorax ebreus
Pathway
dia00010  Glycolysis / Gluconeogenesis
dia00620  Pyruvate metabolism
dia00640  Propanoate metabolism
dia00680  Methane metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_0983
   00620 Pyruvate metabolism
    Dtpsy_0983
   00640 Propanoate metabolism
    Dtpsy_0983
  Energy metabolism
   00680 Methane metabolism
    Dtpsy_0983
Enzymes [BR:dia01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dtpsy_0983
Lipid biosynthesis proteins [BR:dia01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dtpsy_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACM32461
UniProt: B9MF98
Position
1023018..1025015
Genome map
AA seq 665 aa AA seqDB search
MSASSNAIESVLVENRVFPPADSVVKAARVSGMAGYEALCAEANKDPEGFWARLAREHLQ
WTKPFTQTLDESKAPFYQWFADGELNASANCLDKHMGTPVENKAAILFEADDGTVTQVTY
RQLLERVSQFANALKAHGVQQGDRVLIYMPMGVEGVVAMQACARIGATHSVVFGGFSAKA
LNERIIDAGAVAVITANYQLRGGKELPLKAIVDEGLSMGGCDSIKNVFVYQRTATACDMV
AGRDKTFSEILAGQSTECPPTPVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAKVTME
WTFDIRPDDVFWCTADIGWITGHTYVAYGPLAAGATQVVFEGVPTYPNAGRFWQMIERHK
VTVFYTAPTAIRSLIKAADSDESVHPKNWDLSSLRILGSVGEPINPEAWMWYYRHVGGER
CPIVDTFWQTENGGHVITPLPGATPLVPGSCTLPLPGIQAAIVDETGKDLPNGAGGMLVI
KRPWPSMIRTIWGDPERFKKSYFPEELGGTTYLAGDGAVRSADRGYFRITGRIDDVLNVS
GHRMGTMEIESALVAKTDLVAEAAVVGRPDDLTGEAICAFVVLKRSRPTGEEAKQIATEL
RNWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEPITQDTSTLENPAILDQ
LAQSN
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatcgtccaatgccatcgaatccgtattggtggagaaccgcgtcttcccgcct
gccgatagcgtggtgaaggcggcccgcgtgtcgggcatggccggctacgaggccctgtgc
gccgaagccaacaaggatcccgagggcttctgggcgcgcctggcgcgcgagcacctgcaa
tggaccaagccgttcacgcagacgctggacgagtccaaggcgccgttctaccagtggttt
gccgacggcgagctcaacgccagtgccaactgcctggacaagcacatgggcacgccggtc
gagaacaaggccgccatcctcttcgaggccgacgacggcaccgtcacccaggtcacttac
cggcaactgctggagcgcgtgagccagttcgccaatgccctgaaggcgcacggcgtgcag
cagggcgaccgcgtgctcatctacatgccgatgggcgtggaaggcgtggtggccatgcag
gcctgcgcgcgcatcggcgccacgcacagcgtggtgttcggcggtttctctgccaaggcg
ctgaacgagcgcatcatcgatgcgggtgccgtggcggtgatcacggccaactaccaattg
cgcggcggcaaggaactgcccctgaaggccatcgtggacgagggtctgtccatgggcggc
tgcgacagcatcaagaatgtcttcgtataccagcgcacggccacggcctgcgacatggtg
gcggggcgtgacaagaccttctccgagatcctggccgggcagagcaccgaatgcccaccc
acgcccgtgggcgcggagcatccgctgttcatcctctacaccagcggctccacgggcaag
cccaagggcgtgcagcacagcaccggcggctacctgctgtgggccaaggtgacgatggag
tggaccttcgacattcgccccgacgacgtgttctggtgcacggccgatatcggctggatc
acgggccacacctacgtggcctacggcccgctggctgcgggtgccacgcaggtggtgttc
gagggcgtgcccacgtaccccaacgccgggcgcttctggcagatgatcgagcgccacaag
gtcacggtgttctacacggcgcccaccgccatccgctcgctcatcaaggcggccgactcc
gacgagagcgtgcaccccaagaactgggatctgtcgagcctgcgcatcctgggcagcgtg
ggcgagcccatcaaccccgaggcctggatgtggtactaccgccatgtgggcggcgagcgc
tgccccatcgtggacacgttctggcagaccgaaaacggcggccacgtcatcaccccgctg
ccgggtgctacaccgctcgtgccgggttcgtgcaccttgccgctgccgggcatccaggct
gccatcgtcgatgaaaccggcaaagacctgcccaacggcgcgggcggcatgctcgtgatc
aagcggccctggccctcgatgatccgcaccatctggggcgaccccgagcgcttcaagaaa
agctacttccccgaagagctggggggcaccacctacctggccggcgacggcgccgtgcgc
agtgccgaccgtggctacttccgcatcacgggccgcatcgacgacgtgctgaacgtgtcg
ggccaccgcatgggcacgatggagatcgagtccgccctggtcgccaagacggacctcgtg
gctgaggccgccgtggtgggccgtcccgacgacctgacgggcgaggcgatttgcgccttc
gtggtgctcaagcgctcgcgccccacgggcgaggaggccaagcagatcgccaccgaactg
cgcaactgggtcgccaaggagatcggccccatcgccaagcccaaggacatccgcttcggt
gacaacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgctcgatcgcc
aagggcgaacccatcacccaggacaccagcaccctggaaaaccccgcaatcctggatcag
ttggcgcagtccaactga

DBGET integrated database retrieval system