KEGG   Acidovorax ebreus: Dtpsy_1145
Entry
Dtpsy_1145        CDS       T00853                                 

Definition
(GenBank) outer membrane efflux protein
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dia02000]
    Dtpsy_1145
Transporters [BR:dia02000]
 Other transporters
  Pores ion channels [TC:1]
   Dtpsy_1145
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: ACM32618
UniProt: B9MG27
Position
complement(1203865..1205193)
AA seq 442 aa
MLRKDIRKGWIWAVSTLWAGTVLAQPVAAPHVPSRPDSHMVAQLWESAWQRQPEAAGEGA
WQQAAQARQETAGSWVAGPMALEASTKTDRFNNRNGQREYEVGVAIPLWMPGERASSARW
ADAESLALSSRMLAAKLRTAGQVRQAWWAWQRAQAELVAAQDRTRSADELAQDVARRVRA
GDLAQADRNQADGALASARSALAIAQAEEITQREALLALTGIESIPSQADSAQPEQSGVR
VQPASAQPSGALLGNHPALLELQHKALAARRSAELVSHQKYANPELTLATTRDRGGYGER
YNQTITVGVRIPFGTGSRHTEQLSSANAQALEAESALAAQRTRLLSEIRTAQSRELATST
QMQAASERQRLAQQTRTFYQKSFAMGETDMPTRLRIEQEATEAERAALLAKVEHAAAISS
LLQAQGTLPQPTETFTDISGTR
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcttcgcaaagacatacgcaagggatggatatgggcggtatccacgctttgggccggc
accgtgctagcccagccagtagccgcccctcacgtcccatccagaccagacagccacatg
gtcgcccaattgtgggagtcagcttggcagcggcagccagaagccgctggagaaggcgcc
tggcagcaggccgcccaagcacgccaagagacggccggcagttgggtggcaggtccgatg
gcgctggaagcctccaccaaaactgatcggttcaacaaccgcaacggacagcgcgaatat
gaagtcggggtggctattcccctttggatgcctggtgagcgcgcctcgtcggcacgctgg
gcggacgcggaaagcctcgcgctatccagccggatgctggccgccaagctacgcacggcc
ggacaggttcgccaggcatggtgggcatggcagcgtgcccaggccgaattggtggcggcg
caggatcgcacccgcagcgcggacgagttggcgcaagatgtggctcgccgggttcgcgcg
ggcgacctggcgcaagccgacagaaaccaggccgatggcgccttggcgtcggctcgtagt
gccctggccattgctcaggccgaagaaatcacgcagcgcgaggcgttgttggcactgacc
ggcatcgagagtatcccgtcgcaggccgattccgcgcagccggagcagtcaggtgtccga
gttcaaccggcatcggcacagccgtccggcgcgttgttgggtaaccaccctgcgctgctg
gaactgcagcacaaggcgctggcggcccgccgctctgcggaactggtgtcccatcagaag
tacgccaaccccgaactgaccctggcgaccacgcgggatcggggcggctacggcgaacgc
tacaaccagacgatcacggtgggtgtgcgcattcccttcggtacgggtagccgtcatacc
gagcaattgtccagcgccaatgcgcaggcactggaggctgagtcggcactcgcggcccag
cgcacccggctactctcggaaattcgaactgcccaatcgcgcgaactggcaaccagcacc
cagatgcaggccgcttcggagcgccagcgactagcccaacaaacgcgcaccttctaccaa
aagtcgttcgcgatgggcgagacggacatgccgacacgccttcgcatcgagcaggaggcc
accgaggccgagcgcgcggcgctgctcgccaaggtggagcatgccgcggccatctcgtcc
ctgttgcaggcacaaggcacgctgccgcagccgaccgagactttcactgacatctccggc
acgcgctga

DBGET integrated database retrieval system