KEGG   Acidovorax ebreus: Dtpsy_1165
Entry
Dtpsy_1165        CDS       T00853                                 

Definition
(GenBank) putative secreted protein
Organism
dia  Acidovorax ebreus
SSDB
Other DBs
NCBI-ProteinID: ACM32637
UniProt: B9MG46
Position
complement(1228584..1229024)
AA seq 146 aa
MRSNSIKGLALAAAVAVLSGCATSKEELLTHSDRTMMDIWQQETGGGGSGTGQVARRQLL
DARQSLRRPLTDADVQAAPVEQMRYTRTARNEVYRQFQRLPNPDLVMYVYPHLAGTDPVP
VPGYTTVFPLYQRVQYAMPGERLEDY
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcgctcgaactcgattaagggcctcgcgctggccgcggccgtcgccgtgctcagcggt
tgcgccaccagcaaggaagaactgctgacccatagcgaccgcaccatgatggacatctgg
cagcaggaaacgggtggcggcggcagtggcaccggccaggtcgcgcgccggcagttgctc
gacgcgcgccagagcctgcgccggccgctgaccgacgccgatgtgcaggctgcgcccgtc
gagcagatgcgctacacgcgcacggcgcgcaacgaggtttatcgccagttccagcgcctg
cccaaccccgatctcgtcatgtatgtgtacccgcacctggcgggcacggaccccgtgccg
gttccgggctacacgacggtcttccccctgtaccagcgcgtgcagtacgccatgcccggt
gaacggctggaggactattga

DBGET integrated database retrieval system