KEGG   Acidovorax ebreus: Dtpsy_1167
Entry
Dtpsy_1167        CDS       T00853                                 

Definition
(GenBank) putative secreted protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: ACM32639
UniProt: B9MG48
Position
complement(1230413..1231330)
AA seq 305 aa
MKHPVLVLLGLLAVAAAPVSHAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVG
ERLRVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEG
SSTPARYGDQPGGADEAPARAQDQAGTRATRRETPVPVVLTRFAAQNLYAPLRTVESLPG
VMRVNLRRDLDLGTLMPTLPVRAVALASWRLEDQWVTAVRLTNSSSGWVTLDPRVLQGDF
LTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIHRFDPAVHLPQREAEADDGKE
ARHAQ
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagcatcctgtactcgtgctgctggggctgctggccgtggccgcggcacccgtctcc
catgctgtggagattctgcggtgggaacgcatgccgctggcggtgccgctgaaggtcggc
caggagcgcatcgtgttcatcgaccggaacgtccgcgtgggcgtgcccgcaggcgtgggc
gaacgcctgcgcgtgcagagcgcaggtggcgcggtgtacctgcgcgccagcgagccgatc
gagcccacgcggctgcaattgcaggacgccgacacgggcgcgctgatcctgctcgacatt
gcggccgagccgcccaaagacggcgaagccgagctggagccggtgcgcatcgtcgagggc
agcagcacccctgcgcgctacggcgatcagccaggcggtgccgatgaggccccggcacgc
gcccaggaccaagcaggtacgcgggcgacccggcgcgaaaccccggttccggtcgtcctg
acgcgcttcgccgcgcagaacctctacgcgccgctgcgcactgtggagtcgctgcctggc
gtcatgcgggtgaacctgcgccgtgacctcgacctcggcacgctgatgccgacgctgccg
gtgcgcgcggtcgcgctcgcgtcgtggcgtctggaagaccagtgggtcacggccgtgcgc
ctgaccaacagcagcagcggctgggtcacgctcgacccgcgcgtgctgcaaggcgatttc
ctcaccgccaccttccagcacgaagcgctcggaccgcgcgggacgcccgaggacacgacc
gtcctgtacctggtgacgcgcgggcacggcctcgcgcaatcgctgctgccggcgatccac
cgcttcgacccggccgtgcatctgccgcagcgggaagctgaagccgacgatggcaaggag
gcccgccatgcgcagtaa

DBGET integrated database retrieval system