KEGG   Acidovorax ebreus: Dtpsy_1168
Entry
Dtpsy_1168        CDS       T00853                                 

Definition
(GenBank) putative secreted protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACM32640
UniProt: B9MG49
Position
complement(1231327..1232019)
AA seq 230 aa
MSRFKNEITHLQAHIKTLRLGAGALVIVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWW
EVPPESVYAFTFYVFQTLNRWPTNGEEDYPRNLHTLSPYLTPSCQAFLRADYDYRRSTGE
LRQRVRGIYEIPGRGYGDDPTARVRVVSDRDWVVTLDITADEYYGAEQVKRALVRYPVKV
TRVDVDPARNPFGLALDCYDGAPQRISAPEPTRPAPGGLSPQAPQGGNTP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagccgcttcaagaacgagatcacccacctgcaggcgcacatcaagacgcttcgcctg
ggtgctggtgcgctggtcatcgtcgccctggtcatgggcggtggctggtggagcgcgccg
cgcgacctgaccatccacgtcccgcccgacctgcgctcgggcagtacccgcaagtggtgg
gaagtgccgcccgaatcggtctatgcgttcacgttctacgtgttccagaccctcaaccgc
tggccgacgaacggcgaagaggactatccgcgcaacctccacacgctctcgccgtacctt
accccgtcctgccaggccttcctgcgcgcggactacgactaccgccgttccacgggcgag
ctgcgccagcgcgtgcgcgggatttatgagatccccggccgcggctacggcgacgacccc
acggcgcgcgtgcgcgtggtctccgaccgcgactgggtggtgacgctcgacatcaccgcc
gacgagtactacggcgccgagcaggtcaagcgcgcgctcgtgcgctacccggtgaaggtc
acgcgggtggacgtcgatcccgcccgcaaccccttcggcctggcgctggactgctacgac
ggcgcgccccagcgcatcagcgcaccggagccgactcgcccggcacctggcggcctgtct
ccgcaagcgccccaaggaggaaacaccccatga

DBGET integrated database retrieval system