KEGG   Acidovorax ebreus: Dtpsy_1169
Entry
Dtpsy_1169        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF3487 TraL PrgI
Other DBs
NCBI-ProteinID: ACM32641
UniProt: B9MG50
Position
complement(1232016..1232426)
AA seq 136 aa
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTI
AIAPTFVVLGVALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLMAGWVGGHVLIS
RSGFWSTRRSVARGAR
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtccgagcagcagcacgtccgtgcggacgggacggtcacgttccttccgcatcggctc
aaccgccaccctgttgtcgtgcgcggcctcaccgccgacgaactgtggatctgctgcggc
ctgtccggcgccgccggcctgctggtcggcgcgccgctgtcctgggtgttccgcacgatc
gccatcgcgccgacgttcgtcgtcctgggcgtggccctgggcgtcttcatcggcggcggc
atcctgcgccggctcaagcgcgggcgccccgacacctggctgtaccggcaactgcaatgg
cgcatcgccacgcgccatccactgatggcgggatgggtaggcggccacgtgctgatctcg
cgctccggcttctggtccacccgaaggtccgttgcaaggggggcacgatga

DBGET integrated database retrieval system