KEGG   Acidovorax ebreus: Dtpsy_1170
Entry
Dtpsy_1170        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF2976 DUF996 MIG-14_Wnt-bd Arch_flagellin
Other DBs
NCBI-ProteinID: ACM32642
UniProt: B9MG51
Position
complement(1232439..1232798)
AA seq 119 aa
MQNRILHSRLAQRAAVALGSAALPALSFAQGLPQLENPTRGTGNGIMETIRNYGYDIIML
VALLVVASMFIGVCYHAYGTYAEIHTGRKTWGQFGLTVAIGAVLLVIGIWLLTEATGIL
NT seq 360 nt   +upstreamnt  +downstreamnt
atgcaaaaccgcatcctccattcccgccttgcccagcgcgccgctgtggcactgggctcc
gccgcgctgcccgcgctgtcgttcgcgcaaggcttgccgcagttggaaaacccgacccgc
ggcaccggcaacggcatcatggaaacgatcaggaactacggctacgacatcatcatgctc
gtagccctcctggtcgtggcgtcgatgttcatcggcgtctgctaccacgcctacggcacc
tacgcggaaatccacaccggccgcaagacctggggccagtttggcctcaccgtcgcgatc
ggtgccgtgctgctcgtgatcggcatctggctgctcaccgaagccaccggcatcctgtaa

DBGET integrated database retrieval system