KEGG   Acidovorax ebreus: Dtpsy_1171
Entry
Dtpsy_1171        CDS       T00853                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dia  Acidovorax ebreus
SSDB
Motif
Pfam: DUF3262 DUF485 DUF3021 DUF3810
Other DBs
NCBI-ProteinID: ACM32643
UniProt: B9MG52
Position
complement(1232815..1233048)
AA seq 77 aa
MNGAQVSAFQANSGIAPSAMATVLVGAVFAVLLVWGVWAIRTAYVGWSESRLNQRQFLGV
CIRFVAMYLVLSFFLLS
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaacggcgcccaggtctcggcatttcaagccaacagcggcatcgcgccttcggcgatg
gcgaccgtcctggtcggcgccgtgttcgcggtgctcctcgtctggggcgtctgggccatc
cgaacggcctacgtggggtggtccgagagccgcctcaaccagcgccagttcctcggcgtc
tgcatccgcttcgtcgcgatgtacctcgtcctgagcttcttcctcctctcctga

DBGET integrated database retrieval system